DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dyl and Vit

DIOPT Version :9

Sequence 1:NP_647890.2 Gene:dyl / 38531 FlyBaseID:FBgn0066365 Length:611 Species:Drosophila melanogaster
Sequence 2:XP_008762649.1 Gene:Vit / 313831 RGDID:1564128 Length:651 Species:Rattus norvegicus


Alignment Length:277 Identity:61/277 - (22%)
Similarity:98/277 - (35%) Gaps:72/277 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   334 CRYNCPEPK---------------CGPGLPGGEYGLPQIGANGLSEEYGPPEAYE---------- 373
            |...|.:||               ||..:..|.  |...|...|..:......|:          
  Rat    63 CPAGCQDPKYHVYGTGVYASYSSVCGAAVHSGV--LDDSGGKILVRKVAGQSFYKGSYSNGVQSL 125

  Fly   374 -----RNDFALG----GPGVLPPA--AYPDPRHPASDA---TGAYSE-NQPDVVPSPQAQTSA-A 422
                 |..|.:.    ..||..|:  .|..|:..|::|   |.||.: :.|.....|...:.| |
  Rat   126 SLPRWRESFVVSESKPQKGVTYPSTLTYSSPKTAAANAGETTKAYEKPSLPGTTAQPVTLSQALA 190

  Fly   423 VPTADS--GTVSGP---ASSQSPQPQPTG--SNEL----GLPPPPLPGQSGQYSTVKRKDDLSAG 476
            .|.|::  ...|.|   :.:.|.:|||.|  |.|:    ...|.|:...||    ...|::||..
  Rat   191 TPVAEATHRATSKPFAASVTSSSRPQPVGHRSQEMEEMATWKPEPVLLDSG----FVPKEELSTQ 251

  Fly   477 GNLVSLGGRPRSVEGL----DDLRGVRRRRDTMDIVVKPQRIYKRNAQEMTDVNT-SRIIQVVAP 536
            .:...|.|.|.....|    |...|:.:||      .:.|:.:..:..:..|:.. ..::.||..
  Rat   252 SSEPVLQGDPNCKIDLSFLIDGSTGIGKRR------FQIQKQFLVDVVQALDIGPGGPLVGVVQY 310

  Fly   537 GD---VNFALNSNASNE 550
            ||   ..|.|.::.:::
  Rat   311 GDNPATQFNLKTHMNSQ 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dylNP_647890.2 ZP 90..345 CDD:214579 5/25 (20%)
PHA03378 <339..494 CDD:223065 47/210 (22%)
VitXP_008762649.1 LCCL 45..134 CDD:281766 12/72 (17%)
vWA_collagen 265..409 CDD:238749 13/69 (19%)
vWA_collagen 467..627 CDD:238749
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.