DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dyl and Matn2

DIOPT Version :9

Sequence 1:NP_647890.2 Gene:dyl / 38531 FlyBaseID:FBgn0066365 Length:611 Species:Drosophila melanogaster
Sequence 2:XP_216941.8 Gene:Matn2 / 299996 RGDID:1305353 Length:954 Species:Rattus norvegicus


Alignment Length:184 Identity:39/184 - (21%)
Similarity:56/184 - (30%) Gaps:65/184 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VLNTQHLSVHGDASHIESAALPLEHRAGYGPPAPIYGAPQGPLSTGATNDV------------SE 70
            |.|...|......|.:|.|...:.|                 ||||....:            :|
  Rat   104 VKNEFSLKTFKRKSDVERAVKRMRH-----------------LSTGTMTGLAIQYALNIAFSEAE 151

  Fly    71 EAWPLAS---------TNDSPQIKHLQVQCEKTHMRVNIEFDRPFYGMIFS-----------KGF 115
            .|.||..         |:..||....:|..:..:..:          :||:           |..
  Rat   152 GARPLRENVPRVIMIVTDGRPQDSVAEVASKARNTGI----------LIFAIGVGQVDLNTLKAI 206

  Fly   116 YSDPHCVH--LKPGTGHLSATFEIFLN---SCGMTSSANHNAAGYGAPTPSGSY 164
            .|:||..|  |......:.:...:|.|   :..|.|...||.|.:...|| |||
  Rat   207 GSEPHKDHVFLVANFSQIESLTSVFQNKLCTVHMCSVLEHNCAHFCINTP-GSY 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dylNP_647890.2 ZP 90..345 CDD:214579 20/91 (22%)
PHA03378 <339..494 CDD:223065
Matn2XP_216941.8 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.