DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dyl and Matn1

DIOPT Version :9

Sequence 1:NP_647890.2 Gene:dyl / 38531 FlyBaseID:FBgn0066365 Length:611 Species:Drosophila melanogaster
Sequence 2:XP_038965345.1 Gene:Matn1 / 297894 RGDID:1359410 Length:523 Species:Rattus norvegicus


Alignment Length:144 Identity:29/144 - (20%)
Similarity:48/144 - (33%) Gaps:28/144 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   441 QPQPTGSNELGLPPPPLPGQSGQYSTVKRKDDLSAGGN---------LVSLGGRPRSVEGLDDLR 496
            ||..||:         :.|.:.|::..|...|...|.:         :|...|||:     |.:|
  Rat   134 QPLSTGT---------MTGLALQFAITKALSDAEGGRSRSSDISKVVIVVTDGRPQ-----DSVR 184

  Fly   497 GVRRRRDTMDI---VVKPQRIYKRNAQEMTDVNTSRIIQVVAPGDVNFALNSNASNETVVIQSAR 558
            .|..|.....|   .:...|:.|...:::........:..|...:|...|.........|.....
  Rat   185 DVSERARASGIELFAIGVGRVDKATLRQIASEPQDEHVDYVESYNVIEKLAKKFQEAFCVSDLCA 249

  Fly   559 SAD--AETICMSVP 570
            :.|  .|.:|:|.|
  Rat   250 TGDHYCEQVCVSSP 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dylNP_647890.2 ZP 90..345 CDD:214579
PHA03378 <339..494 CDD:223065 13/61 (21%)
Matn1XP_038965345.1 vWA_Matrilin 60..282 CDD:238752 29/144 (20%)
vWFA 293..497 CDD:412136
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X161
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.