DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dyl and cutl-25

DIOPT Version :9

Sequence 1:NP_647890.2 Gene:dyl / 38531 FlyBaseID:FBgn0066365 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_497651.2 Gene:cutl-25 / 190305 WormBaseID:WBGene00021919 Length:385 Species:Caenorhabditis elegans


Alignment Length:284 Identity:55/284 - (19%)
Similarity:98/284 - (34%) Gaps:80/284 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 VQCEKTHMRVNIEFDRPFYGMIFSKGFYSDPHCVHLKPGTGHLSATFEIFLNSCGMTSSANH--- 150
            |.|....:.:..|.:..|.|.|:.||....|.|          |.:::|..||..:....|.   
 Worm    33 VSCRSDAISLVAETEDFFEGQIYVKGSRGTPSC----------SKSYQITQNSTALELKINAQEL 87

  Fly   151 NAAGYGA-PTPSGS--YVENTIIIQYDPYVQEVWDQARKLRCTWYDFYEK--------------- 197
            ...|:.| |.|:..  .:...:|:.:.|.:....|:|.:..|.:.||..|               
 Worm    88 EKCGFRAWPKPNSKMWLLSGQVIVAFHPTLVTPSDRAFRAHCEFEDFKRKTEIGIENLIQEHELI 152

  Fly   198 ---------AVTFRPFQVDMLHAVTANFLGDNLQCWMQIQVGKGPWASEVSGIVKIGQTMTMVLA 253
                     ::...|...:.|...|.||..:..:                  ::.:|..:.....
 Worm   153 LGNFQLPKISMHILPAGEESLTTKTQNFEANEQK------------------VLNVGDPIMFEWK 199

  Fly   254 IKDDENKFDMLVRNCVA--HDGKRAPIQLVDQNGCVVRPKIMS------KFQKIKNFGPSASVVS 310
            ::.:...|.:.:..|.|  .:||...|.   :|||.:..:::|      .|.||           
 Worm   200 LEQEHGIFGIQLERCSAESENGKGMKIL---ENGCSLDEELISDTTYSQDFSKI----------- 250

  Fly   311 FAYFQAFKFPDSMNVHFQCVIQVC 334
            :|...|||||:...|..:|.::.|
 Worm   251 YATSLAFKFPEEYEVFIRCAVRTC 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dylNP_647890.2 ZP 90..345 CDD:214579 54/283 (19%)
PHA03378 <339..494 CDD:223065
cutl-25NP_497651.2 Zona_pellucida 35..276 CDD:391783 54/282 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107918
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.