DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dyl and cutl-11

DIOPT Version :9

Sequence 1:NP_647890.2 Gene:dyl / 38531 FlyBaseID:FBgn0066365 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_001361820.1 Gene:cutl-11 / 188066 WormBaseID:WBGene00011443 Length:379 Species:Caenorhabditis elegans


Alignment Length:265 Identity:55/265 - (20%)
Similarity:101/265 - (38%) Gaps:28/265 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 ASTNDSPQIKHLQVQCEKTHMRVNIEFDRPFYGMIFSKGFYSDPHC---VHLKPGTGHLSATFEI 137
            |..:|:..|...::||....:.:.....:.|.|.::.||.|:.|.|   ...|...|......::
 Worm    18 AIQDDNELIGQPEIQCNADTIDMQFRTRKQFNGKVYVKGSYNRPECRVDYSTKDQFGRPVGGIKL 82

  Fly   138 FLNSCGMTSSANHNAAGYGAPTPSGSYVENTIIIQYDPYVQEVWDQARKLRCTWYDFYEKAVTFR 202
            ...:|.|....        ...|.|......:||.:.|......|:|..:||    .|::|....
 Worm    83 NHGACNMDRQR--------MIAPEGMMFSTVLIISFHPLFLTRMDKAYHIRC----MYKEAARTV 135

  Fly   203 PFQVDMLHAVTANFLGDNLQCWMQIQVGKGPWASEVSGIVKIGQTMTMVLAIKDDENKFDMLVRN 267
            ...:|:.:..|.:...|.........:.:......:....|:|.  .:|...:.|...:.:||.:
 Worm   136 TAAIDVSNLPTESVQSDLPMPTCSYTIRRDQLDGPILKYAKVGD--QVVHRWQCDSEDYGLLVHS 198

  Fly   268 CVAHDGKRAPIQLVDQNGCVVRPKIMSKFQKIKNFGPS-ASVVSFAYFQA--FKFPDSMNVHFQC 329
            |...||:.....::|:.||.....::.        .|: ...::.||.::  |||.|.:.|.|||
 Worm   199 CYVEDGQGEKQMIIDERGCHTDRLLLG--------DPTYVEALNMAYRESFVFKFADRIAVRFQC 255

  Fly   330 VIQVC 334
            .|::|
 Worm   256 EIRLC 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dylNP_647890.2 ZP 90..345 CDD:214579 52/251 (21%)
PHA03378 <339..494 CDD:223065
cutl-11NP_001361820.1 ZP 32..278 CDD:214579 52/251 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107918
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X161
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.