DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dyl and cut-5

DIOPT Version :9

Sequence 1:NP_647890.2 Gene:dyl / 38531 FlyBaseID:FBgn0066365 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_001257100.1 Gene:cut-5 / 187677 WormBaseID:WBGene00011104 Length:395 Species:Caenorhabditis elegans


Alignment Length:317 Identity:66/317 - (20%)
Similarity:124/317 - (39%) Gaps:77/317 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 VQCEKTHMRVNI--------------EFD--RPFYGMIFSKGFYSDPHCVHLKPGTGHL-SATFE 136
            |:|......|||              :||  ..|:|:.|.:....:|.|......|... :::..
 Worm    30 VECGDDFFEVNIYHSCSCVGNFIIKVKFDTRTTFHGLAFVQNHLDNPDCRSFASKTDSAKNSSLR 94

  Fly   137 IFLNSCGMTSSANHNAAGYGAPTPSGSYVENTIIIQYDPYVQEVWDQARKLRCTWYDFYEKAVTF 201
            :..:.|.:  ...|:.      :|.|.::...:::.::|......|:..|::| :|...|:.:. 
 Worm    95 LTFDQCAI--EKRHST------SPRGLFLSTNVVVAFNPEFLTKNDRVFKVQC-FYMEMERRIQ- 149

  Fly   202 RPFQVDM----LHAVTANFLGDNLQCWMQIQVGK--GP---WASEVSGIVKIGQTMTMV----LA 253
            :..|:.|    :|:...|.    ..|..::..|.  ||   :|:       :||   ||    ..
 Worm   150 KVIQISMPPPTMHSKQLNM----PVCKYEVLDGSPTGPPVYFAT-------VGQ---MVYHKWTC 200

  Fly   254 IKDDENKFDMLVRNCVAHDGKRAPIQLVDQNGCVVRPKIMSKFQKIKNF--GPSASVVSFAYFQA 316
            ..:.||.|.|||.:|...||....:||::..||.:...:::..:...:.  |..|.|        
 Worm   201 DTEHENTFCMLVHSCFVDDGNGQRVQLLNDKGCALDKYLLTNLEYPTDLMAGREAHV-------- 257

  Fly   317 FKFPDSMNVHFQCVIQV---------CRY-NCPEP---KCGPGLPGGEYGLPQIGAN 360
            :|:.|..|::|.|.|.:         |.. :||:|   :....||..:..:..|.|:
 Worm   258 YKYADRDNMYFDCQISITVKEPGLDYCDVPSCPDPPRRRRSNTLPAPDDNITAIAAH 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dylNP_647890.2 ZP 90..345 CDD:214579 61/299 (20%)
PHA03378 <339..494 CDD:223065 6/25 (24%)
cut-5NP_001257100.1 Zona_pellucida 53..290 CDD:421542 54/268 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 82 1.000 Domainoid score I5383
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107918
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X161
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.