DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dyl and cutl-3

DIOPT Version :9

Sequence 1:NP_647890.2 Gene:dyl / 38531 FlyBaseID:FBgn0066365 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_510492.2 Gene:cutl-3 / 184721 WormBaseID:WBGene00008978 Length:405 Species:Caenorhabditis elegans


Alignment Length:302 Identity:64/302 - (21%)
Similarity:106/302 - (35%) Gaps:95/302 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 VQCEKTHMRVNIEFDRPFYGMIFSKGFYSDPHCVHLKPGTGHLSATFEIFLN------SCGMTSS 147
            ::|....:.:|.:....|.|.::.||.||..||        ...||.|..:|      :|.:...
 Worm    32 IRCGSESLSINFKTQGAFEGHVYVKGHYSMKHC--------RTDATLESQVNLTVSYSACDVIRQ 88

  Fly   148 ANHNAAGYGAPTPSGSYVENTIIIQYDPYVQEVWDQARKLRCTWYDFYEKAVTFRPFQVDM---- 208
            .:.|        |.|..:..||||.:.|......|::.|::| :|...:|.|| :...||:    
 Worm    89 RSSN--------PKGIMMTATIIISFHPMFITKIDKSYKVQC-FYAEAQKTVT-QQLNVDIAKEQ 143

  Fly   209 -------------------------LHAV----TANFLGDNL---QCWMQI-------------- 227
                                     ||.:    |...:..|:   .|..::              
 Worm   144 EKKIFVMVGDEEGGTVSHTTGDQKKLHKLNDPSTEERISYNVPLPDCKYRVLTESKTEEVAFATV 208

  Fly   228 -QVGKGPWASEVSGIVKIGQTMTMVLAIKDDENKFDMLVRNCVAHDGKRAPIQLVDQNGCVVRPK 291
             |:....|:.|..|              ::..:.|.:.|.:|...|.....:|:.|:|||.|...
 Worm   209 GQIVYHEWSCEAPG--------------QNQTSPFCVTVHSCNVKDETGKEVQIFDENGCAVDKY 259

  Fly   292 IMSKFQKIKNFGPSASVVSFAYFQAFKFPDSMNVHFQCVIQV 333
            :      |.|...|:.:......|.|||.|..:|.|||.|::
 Worm   260 L------INNLEYSSDLTGGQLSQVFKFADQPSVFFQCKIRL 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dylNP_647890.2 ZP 90..345 CDD:214579 64/301 (21%)
PHA03378 <339..494 CDD:223065
cutl-3NP_510492.2 ZP 33..306 CDD:214579 64/301 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 82 1.000 Domainoid score I5383
eggNOG 1 0.900 - - E1_28NIE
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107918
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X161
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.710

Return to query results.
Submit another query.