DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dyl and cutl-14

DIOPT Version :9

Sequence 1:NP_647890.2 Gene:dyl / 38531 FlyBaseID:FBgn0066365 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_492780.2 Gene:cutl-14 / 182018 WormBaseID:WBGene00015231 Length:270 Species:Caenorhabditis elegans


Alignment Length:271 Identity:65/271 - (23%)
Similarity:120/271 - (44%) Gaps:41/271 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 HLQVQCEKTHMRVNIEFDRPFYGMIFSKGFYSDPHCVHLKPGTGHLSATFEIFLNSCGMTSSANH 150
            :::|:|..|.:......:..|.|.:|..|...|..||..:  ||..:.:..:..:.||:.:..:.
 Worm    28 NVEVECTDTTIEAVFLTETNFLGRVFVLGHSQDKDCVSRE--TGRRTTSITVPRDKCGVETVQHG 90

  Fly   151 NAAGYGAPTPSGSYVENTIIIQYDPYVQEVWDQARKLRCTWY---DFYEKAVTFRPFQVDMLHAV 212
            ..|||.:..       |.:|..:|.::.:| |:|..:.|.:.   |....|:|.:|   .:|..:
 Worm    91 KGAGYTSSV-------NIVISFHDKFLTKV-DRAYNITCLYAPTGDVVSYALTVQP---SLLKDI 144

  Fly   213 TANFLGDNLQCWMQIQVGKGPWASEVSGIVKIGQTMTMVLAIKDDEN--KFDMLVRNCVAHDGK- 274
              ..|.:...|..::...:....:|   ||.:...:..|... |..|  .|.|.|.:||.::|| 
 Worm   145 --QVLAEQPSCEYEVFDVRTRRPAE---IVHVNAPLEHVWTC-DGTNLDLFCMTVHDCVINEGKS 203

  Fly   275 RAPIQLVDQNGCVV----RPKIMSKFQKIKNFGPSASVVSFAYFQAFKFPDSMNVHFQCVIQVCR 335
            :...:::|..||.:    .|.:..:..|:     ||.|:|    :||:|.|.:.|.|:|.:::..
 Worm   204 KRRSKIIDSEGCSLDTTRLPNLRYENNKL-----SARVMS----KAFRFGDDVAVEFECNVRLDL 259

  Fly   336 YN---CPEPKC 343
            .|   ||.|:|
 Worm   260 RNGTSCPRPRC 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dylNP_647890.2 ZP 90..345 CDD:214579 64/267 (24%)
PHA03378 <339..494 CDD:223065 3/5 (60%)
cutl-14NP_492780.2 ZP 32..270 CDD:214579 63/265 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 82 1.000 Domainoid score I5383
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107918
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.