DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dyl and cutl-24

DIOPT Version :9

Sequence 1:NP_647890.2 Gene:dyl / 38531 FlyBaseID:FBgn0066365 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_001023450.1 Gene:cutl-24 / 176831 WormBaseID:WBGene00021396 Length:601 Species:Caenorhabditis elegans


Alignment Length:112 Identity:39/112 - (34%)
Similarity:69/112 - (61%) Gaps:6/112 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 MQIQVGKGPWASEVSGIVKIGQTMTMVLAIK---DDENKFDMLVRNCVAHDGK-RAPIQLVDQNG 285
            ::||.|:||:|..|:..:|||..:::|:..|   ::.::|||.|.:|.|.||| ...:|::|:||
 Worm   399 LEIQRGEGPFAPPVTTPIKIGDNISLVVKAKSYLNETDQFDMFVHSCFATDGKGDTKVQMIDENG 463

  Fly   286 CVVRPKIMSKFQKIKNFGPSASVVSFAYFQAFKFPDSMNVHFQCVIQ 332
            ||:|.:..|...:.|:  ...::..:...:|||||...:|:|.|.|:
 Worm   464 CVIRLEFASPLHRAKD--SENTMFYYLLIKAFKFPGPDDVYFSCTIE 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dylNP_647890.2 ZP 90..345 CDD:214579 39/112 (35%)
PHA03378 <339..494 CDD:223065
cutl-24NP_001023450.1 Zona_pellucida 34..>92 CDD:391783
PHA03247 <169..415 CDD:223021 7/15 (47%)
Zona_pellucida <388..516 CDD:391783 39/112 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167952
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005923
OrthoInspector 1 1.000 - - otm14287
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46560
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.