DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dyl and cut-6

DIOPT Version :9

Sequence 1:NP_647890.2 Gene:dyl / 38531 FlyBaseID:FBgn0066365 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_499400.2 Gene:cut-6 / 176520 WormBaseID:WBGene00000853 Length:572 Species:Caenorhabditis elegans


Alignment Length:310 Identity:78/310 - (25%)
Similarity:117/310 - (37%) Gaps:74/310 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 WPLASTNDSPQIKHLQVQCEKTHMRVNIEFDRPFYGMIFSKGFYSDPHCVHLKPGTGHLSATFEI 137
            |.:..|...|...  ::.|....:.|.....:||.|.:|....|.|..|          .|..|.
 Worm   218 WSMCKTEFRPGTP--EIICGPDRIGVKASTKQPFEGNVFVMDHYHDEEC----------RAGPEK 270

  Fly   138 F--LNSCGMT---SSAN-HNAAGYGAPTPSGSYVENTIIIQYDPYVQEVWDQARKLRCTWYDFY- 195
            |  ..|.|:|   |:.| |.   |.:..|.|.:||.:|:..:........||..|::|    || 
 Worm   271 FPDSRSIGLTVPFSACNVHR---YRSLNPKGIFVEVSIVFMFHSLFMTKTDQTVKVQC----FYM 328

  Fly   196 --EKAVTFRPFQVDMLHAVTANFLGDNLQCWMQIQVG--KGP--------------W-ASEVSGI 241
              :|.||. |..|.|:..|....:....||...::.|  .||              | ..||.|.
 Worm   329 EADKHVTV-PLSVSMITTVFREQIYQMPQCAYTLRKGAPDGPIVRFATLGESVYHRWECIEVEGA 392

  Fly   242 VKIGQTMTMVLAIKDDENKFDMLVRNCVAHDGKRAPIQLVDQNGCVVRPKIMSKFQKIKNFGPSA 306
                           |::.|.|||.:|...:|....:.::|.|||.:...::|    ..::..|.
 Worm   393 ---------------DKDTFGMLVHSCYVDNGYGDRVDILDSNGCGLDAVLLS----TPDYDTSL 438

  Fly   307 SVVSFAYFQAFKFPDSMNVHFQCVIQVC-RYN--C----PEPKCGPGLPG 349
            .:.:..| ..||:.|...:.|||.|.:| :|:  |    |...| ..|||
 Worm   439 RLATKPY-HVFKYADRPVLQFQCQITLCLKYDGGCEGITPPQNC-KKLPG 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dylNP_647890.2 ZP 90..345 CDD:214579 72/287 (25%)
PHA03378 <339..494 CDD:223065 5/11 (45%)
cut-6NP_499400.2 VWA 48..208 CDD:395045
ZP 233..480 CDD:214579 71/284 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107918
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X161
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.