DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dyl and dpy-1

DIOPT Version :9

Sequence 1:NP_647890.2 Gene:dyl / 38531 FlyBaseID:FBgn0066365 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_001370799.1 Gene:dpy-1 / 175342 WormBaseID:WBGene00001063 Length:1427 Species:Caenorhabditis elegans


Alignment Length:288 Identity:61/288 - (21%)
Similarity:106/288 - (36%) Gaps:45/288 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 ASTNDSPQIKHLQVQCEKTHMRVNIEFDRPFYGMIFSKGFYSDPHCVHLKPGTGHLSATFEIFL- 139
            |.|.::..|  :.::|.....:|.:.....|.|:...||:..|..|    ..|...|....:|: 
 Worm  1038 AETAENSGI--IDLECVGDGFKVQVNPPAGFRGVAVVKGYQDDARC----KATASSSLPLNLFIS 1096

  Fly   140 -NSCGMTSSANHNAAGYGAPTPSGSYVENTIIIQYDPYVQEVWDQARKLRCTWYDFYEKAVTFRP 203
             |.||:|...:.:        |:|......:.:.:|..:....|:|..|:|......:.||....
 Worm  1097 NNECGVTQVKSSD--------PNGLNSSLVLHLLHDDELNTAEDRAYLLQCFIGAQNQDAVVSTN 1153

  Fly   204 FQV---DMLHAVTANFLGDNLQCWMQIQVGKGPWASEVSGIVKIGQTM--------TMVLAIKDD 257
            ..|   ::..|.|.:.......|...|: .:||....||..| :|||:        |     .|.
 Worm  1154 LNVVRSELAIAETISLSTLPPTCTYSIR-KEGPEGPIVSRAV-VGQTVWHRWECDGT-----NDT 1211

  Fly   258 ENKFDMLVRNCVAHDGKRAPIQLVDQNGCVVRPKIMSKFQKIKNFGPSASVVSFAYFQAFKFPDS 322
            ...:.:.|.:|.|.|........||..||.....:::......:     |:.::|....|...|:
 Worm  1212 NQAYGIQVHSCYASDDVERKFAFVDPRGCSSDLALLTDLTYADD-----SLTAWAASHVFNVHDA 1271

  Fly   323 MNVHFQCVIQVCRYN---C---PEPKCG 344
            .::.|.|.:.:|..:   |   ..|.||
 Worm  1272 ESLKFVCKLSLCTRDGDGCEGVTPPACG 1299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dylNP_647890.2 ZP 90..345 CDD:214579 58/274 (21%)
PHA03378 <339..494 CDD:223065 3/6 (50%)
dpy-1NP_001370799.1 VWA 823..975 CDD:395045
Zona_pellucida 1050..1299 CDD:421542 56/272 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 82 1.000 Domainoid score I5383
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107918
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.