DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dyl and cutl-2

DIOPT Version :10

Sequence 1:NP_647890.2 Gene:dyl / 38531 FlyBaseID:FBgn0066365 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_496097.1 Gene:cutl-2 / 174532 WormBaseID:WBGene00013145 Length:382 Species:Caenorhabditis elegans


Alignment Length:83 Identity:21/83 - (25%)
Similarity:37/83 - (44%) Gaps:18/83 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 RKRAPNRKRTKPGEGVRPDEVDDSQSEEKTDTD-KNMTIMFNILGKKKRVQLENLVL--NRRSFA 258
            ||::|..|.::       ||.....|...||.| .|::::..:|..|..|.|..|::  |..|..
 Worm   629 RKQSPLLKLSR-------DETSVDSSSNLTDKDADNVSLVLRLLASKNGVVLRRLLMAANGTSLI 686

  Fly   259 QTVENLFALSFLAKDGRV 276
            :|        |::::..|
 Worm   687 RT--------FISREALV 696

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dylNP_647890.2 ZP 90..345 CDD:214579 21/83 (25%)
PHA03378 <339..494 CDD:223065
cutl-2NP_496097.1 ZP 28..286 CDD:214579
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.