DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dyl and cutl-2

DIOPT Version :9

Sequence 1:NP_647890.2 Gene:dyl / 38531 FlyBaseID:FBgn0066365 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_496097.1 Gene:cutl-2 / 174532 WormBaseID:WBGene00013145 Length:382 Species:Caenorhabditis elegans


Alignment Length:303 Identity:70/303 - (23%)
Similarity:124/303 - (40%) Gaps:57/303 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 IKHL--------QVQCEKTHMRVNIEFDRPFYGMIFSKGFYSDPHCVHLKPGTGHLSATFEIFLN 140
            |:|:        :::|..|.:.:.:|.|.||.|.:|.:|......|..........:.:||...:
 Worm    14 IQHVNSDIIGEPKIRCAPTGITIMLETDSPFKGALFLRGSADKKSCKANFSAQPSQNISFEFGFD 78

  Fly   141 SCGMTSSANHNAAGYGAPTPSGSYVENTIIIQYDPYVQEVWDQARKLRCTWYDFYEKAVTFRPFQ 205
            .|.........|       |.|..:.:.:::.|...:....|.|.::.|    ||.:..:    :
 Worm    79 DCPSRRKRQIVA-------PRGMTMSSVLVVSYHGSIITHRDVAYQIDC----FYREENS----R 128

  Fly   206 VDMLHAVTA---NFLGDNLQ---CWMQIQVGKGPWASEVSGIV--KIGQTMTMVLAIKDD----- 257
            |:.:.:|.|   ..|.|..:   |..:::|..|  .:...|||  .:.:|.:.:..:.|.     
 Worm   129 VETMLSVNAPQPRILSDEPKLPTCDYRVEVTGG--KAVAGGIVTSSLSETASQIANVGDSVIHIW 191

  Fly   258 -------ENKFDMLVRNCVAHDGKRAPIQLVDQNGCVVRPKIMSKFQKIKNFGPSASVVSFAYFQ 315
                   .:.:.:.|.:|.|.||....:|:||:|||....:::|.. |.|    ..|:.:.|...
 Worm   192 TCSGDAPSDVYCIQVYSCTAEDGGSDTVQVVDENGCTTDGELLSPI-KYK----EGSMRAAASSH 251

  Fly   316 AFKFPDSMNVHFQCVIQVCRYN----CPEPKCGPGLPGGEYGL 354
            ||||.|:..|:|:|.|::...|    ||...|.   |.|..||
 Worm   252 AFKFVDNHIVYFKCNIRITVKNPSGECPVNNCS---PNGSTGL 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dylNP_647890.2 ZP 90..345 CDD:214579 64/278 (23%)
PHA03378 <339..494 CDD:223065 6/16 (38%)
cutl-2NP_496097.1 ZP 28..286 CDD:214579 64/282 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 82 1.000 Domainoid score I5383
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107918
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X161
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.