DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dyl and cutl-15

DIOPT Version :9

Sequence 1:NP_647890.2 Gene:dyl / 38531 FlyBaseID:FBgn0066365 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_495904.2 Gene:cutl-15 / 174426 WormBaseID:WBGene00011888 Length:385 Species:Caenorhabditis elegans


Alignment Length:219 Identity:44/219 - (20%)
Similarity:82/219 - (37%) Gaps:81/219 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 PSGSYVENTIIIQYDPYVQEVWDQARKLRCTWYDFYEKAVTFRPFQVDMLHAVTANFLGDNLQCW 224
            |:|..:|.::.:.:.|....|.|:...::|    |::|.:.                 |.:    
 Worm    99 PTGVILEVSLSVSFHPEFTTVDDRIFNMQC----FHQKKIN-----------------GTS---- 138

  Fly   225 MQIQVG---------KGPWAS-EV---SGIVKIGQTMTMVLAIKDD-------ENKFD--MLVRN 267
            ..:.:|         |||..| ||   .|.:..|:     ||:..|       :|.::  :::.|
 Worm   139 TSLAIGSPKPPPSDTKGPSCSYEVLTSPGGLPAGR-----LALGQDVYHSWQCQNVYESCIMIEN 198

  Fly   268 CVAHDGKRAPIQLVDQNGCVVRPKIMSKFQ---------KIKNFGPSASVVSFAYFQAFKFPDSM 323
            |....|:... :::|.:||.....||.:.:         .:|.||.|.:.:              
 Worm   199 CELVGGEETH-EVIDSSGCSKHESIMPQLEYHNRTHVGTSVKVFGVSHTSI-------------- 248

  Fly   324 NVHFQCVI----QVCRYNCPEPKC 343
             |:|.|.:    |:....||:|||
 Worm   249 -VYFACQVRLHPQLPTGECPKPKC 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dylNP_647890.2 ZP 90..345 CDD:214579 44/219 (20%)
PHA03378 <339..494 CDD:223065 4/5 (80%)
cutl-15NP_495904.2 ZP 41..272 CDD:214579 44/219 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 82 1.000 Domainoid score I5383
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107918
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.