DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dyl and cut-3

DIOPT Version :9

Sequence 1:NP_647890.2 Gene:dyl / 38531 FlyBaseID:FBgn0066365 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_495780.1 Gene:cut-3 / 174347 WormBaseID:WBGene00009041 Length:389 Species:Caenorhabditis elegans


Alignment Length:278 Identity:64/278 - (23%)
Similarity:110/278 - (39%) Gaps:56/278 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 QVQCEKTHMRVNIEFDRPFYGMIFSKGFYSDPHCVHLKPGTGHLSATFEIFLNSCGMTSSANHNA 152
            :|:|..|.:.||......|.|.::.||.:....|  .....|...|..|:..::|.:..:.:.| 
 Worm    31 EVECGPTSITVNFNTRNAFEGHVYVKGLFDQQEC--RNDEGGRQVAGIELPFDTCNVARTRSLN- 92

  Fly   153 AGYGAPTPSGSYVENTIIIQYDP-YVQEVWDQARKLRCTWYDFYEKAVTFRPFQVDMLHAVTANF 216
                   |.|.:|..|:::.:.| :|.:| |:|.:::|    ||.:|......|:::....||  
 Worm    93 -------PKGVFVTTTVVVSFHPQFVTKV-DRAYRVQC----FYMEADKTVSTQIEVSDLTTA-- 143

  Fly   217 LGDNLQCWMQIQV-----------GKGPWASEVSGIVKIGQTMTMVLAIKDDE--NKFDMLVRNC 268
                    .|.||           ..||....|. ...|||.:...... |.|  :.|..:|.:|
 Worm   144 --------FQTQVVPMPICKYEILNGGPTGEPVQ-FATIGQQVYHKWTC-DSETVDTFCAVVHSC 198

  Fly   269 VAHDGKRAPIQLVDQNGCVVRPKIMSKFQKIKNFGPSASVVSFAYFQAFKFPDSMNVHFQCVIQV 333
            ...||....:|::|:|||.     :.|| .:.|......:::......:|:.|...:.:||.|.:
 Worm   199 TVDDGNGDTVQILDENGCA-----LDKF-LLNNLEYPTDLMAGQEAHVYKYADRSQLFYQCQISI 257

  Fly   334 ---------CRYNCPEPK 342
                     .|..|.||:
 Worm   258 TVKEPNEECARPTCSEPQ 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dylNP_647890.2 ZP 90..345 CDD:214579 63/276 (23%)
PHA03378 <339..494 CDD:223065 2/4 (50%)
cut-3NP_495780.1 ZP 33..272 CDD:214579 60/271 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 82 1.000 Domainoid score I5383
eggNOG 1 0.900 - - E1_28NIE
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107918
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X161
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.710

Return to query results.
Submit another query.