DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dyl and cutl-10

DIOPT Version :9

Sequence 1:NP_647890.2 Gene:dyl / 38531 FlyBaseID:FBgn0066365 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_492900.1 Gene:cutl-10 / 173021 WormBaseID:WBGene00013180 Length:403 Species:Caenorhabditis elegans


Alignment Length:271 Identity:75/271 - (27%)
Similarity:117/271 - (43%) Gaps:36/271 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 QVQCEKTHMRVNIEFDRPFYGMIFSKGFYSDPHCVHLKPGTGHLSATFEIFLNSCGMTSSANHNA 152
            :|.|.:..::::.:..|||:|.||.||......||.....:.....|||:...:|.|   .....
 Worm    32 EVDCMEDRVKLSFKTQRPFHGRIFVKGMVDKQACVRDFVTSQAKDVTFELENGACNM---RRQRM 93

  Fly   153 AGYGAPTPSGSYVENTIIIQY-DPYVQEVWDQARKLRCT-WYDFYEKAVTFRPFQVDMLHAVTAN 215
            .|   |...|..:..|:||.: ..::.:|   .|..||| :|...:|.|| ..|.|.||  .|.:
 Worm    94 LG---PEKRGMEMSMTVIISFHSTFITKV---DRAYRCTCFYMEADKVVT-NKFDVSML--PTTD 149

  Fly   216 FLGDNLQCWMQIQVGKGPWASEVSGIVKIGQTMTMVLAIKDDENKFDMLVRNCVAHDG---KRAP 277
            .:...........|.:......:....|:|:|:..|...:.|  .|.|||.:|...||   :|.|
 Worm   150 LIDTARMPLCTYSVRRDSITGPIVEFAKVGETVYHVWNCESD--MFSMLVHSCFVDDGNGDERKP 212

  Fly   278 IQLVDQNGCVVRPKIMS--KFQKIKNFGPSASVVSFAYFQAFKFPDSMNVHFQCVIQVCRYN--- 337
              |:|::||.:.|.|:.  .:.|..|       |::|....|||.|.::.:|||.:..|...   
 Worm   213 --LLDEHGCAIDPLILPDLTYNKDNN-------VAYAQVNTFKFADKVSTYFQCAVSTCMNTEGM 268

  Fly   338 C---PEPKCGP 345
            |   ..|:|||
 Worm   269 CDGKTPPRCGP 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dylNP_647890.2 ZP 90..345 CDD:214579 72/267 (27%)
PHA03378 <339..494 CDD:223065 4/7 (57%)
cutl-10NP_492900.1 ZP 35..279 CDD:214579 72/266 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107918
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X161
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.