DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment dyl and Matn3

DIOPT Version :9

Sequence 1:	NP_647890.2	Gene:	dyl / 38531	FlyBaseID:	FBgn0066365	Length:	611	Species:	Drosophila melanogaster
Sequence 2:	NP_034900.4	Gene:	Matn3 / 17182	MGIID:	1328350	Length:	481	Species:	Mus musculus

Alignment Length:	132	Identity:	33/132 - (25%)
Similarity:	52/132 - (39%)	Gaps:	23/132 - (17%)

- Green bases have known domain annotations that are detailed below.

  Fly   452 LPPPPLPGQSGQYSTVKRKDDLSAG--GNLVSLGGRPRSVEGLDDLRGVRRRRDTMDIV------ 508
            ||....||:..:.|..:....:..|  |:|.:|....|:........||.:.| .:|:|
Mouse    23 LPSLAAPGRLARASVRRLGTRVPGGSPGHLSALATSTRAPYSGGRGAGVCKSR-PLDLVFIIDSS 86

  Fly   509 --VKPQRIYKRNAQEMTDVNT--SRIIQVVAPG--DVNFALNSNASNETVVIQSARSADAETICM 567
              |:|        .|.|.|.|  ||||..:..|  |...|:.:.||...:..|....:|.:.:..
Mouse    87 RSVRP--------LEFTKVKTFVSRIIDTLDIGATDTRVAVVNYASTVKIEFQLNTYSDKQALKQ 143

  Fly   568 SV 569
            :|
Mouse   144 AV 145

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
dyl	NP_647890.2	ZP	90..345	CDD:214579
dyl	NP_647890.2	PHA03378	<339..494	CDD:223065	10/43 (23%)
Matn3	NP_034900.4	vWFA	75..298	CDD:294047	21/80 (26%)
		FXa_inhibition	305..341	CDD:291342
		FXa_inhibition	347..383	CDD:291342
		FXa_inhibition	389..425	CDD:291342
		Matrilin_ccoil	438..478	CDD:287378
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	1	1.000	-	-		X161
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.000