| Sequence 1: | NP_647890.2 | Gene: | dyl / 38531 | FlyBaseID: | FBgn0066365 | Length: | 611 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_006510860.1 | Gene: | Col12a1 / 12816 | MGIID: | 88448 | Length: | 3120 | Species: | Mus musculus |
| Alignment Length: | 238 | Identity: | 50/238 - (21%) |
|---|---|---|---|
| Similarity: | 78/238 - (32%) | Gaps: | 70/238 - (29%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 338 CPEPKCGPGLPGGEYGLPQIGANGLSEEYGPPEAYERNDFALGGPGVLPPAAYPDPRHPASDATG 402
Fly 403 AYSENQPDVVPSPQAQTSAAVP--------TADSGTVSGPASSQSPQPQPTGSNELGLPPPPLP- 458
Fly 459 ------GQSGQYSTVKRKDDLSAGGNLVSLG--------------GRPRSVEGLDDLRGVRRRRD 503
Fly 504 TMDIVVKPQRIYKRNAQEMTDVNTSRIIQVV--APGDVNFALN 544 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dyl | NP_647890.2 | ZP | 90..345 | CDD:214579 | 1/6 (17%) |
| PHA03378 | <339..494 | CDD:223065 | 40/183 (22%) | ||
| Col12a1 | XP_006510860.1 | fn3 | 26..105 | CDD:365830 | |
| vWA_collagen_alphaI-XII-like | 139..302 | CDD:238759 | |||
| fn3 | 336..415 | CDD:365830 | |||
| vWA_collagen_alphaI-XII-like | 439..602 | CDD:238759 | |||
| FN3 | 634..719 | CDD:238020 | |||
| FN3 | 724..805 | CDD:238020 | |||
| fn3 | 817..893 | CDD:365830 | |||
| fn3 | 906..986 | CDD:365830 | |||
| FN3 | 1002..1075 | CDD:238020 | |||
| FN3 | 1090..1176 | CDD:238020 | |||
| vWA_collagen_alphaI-XII-like | 1198..1361 | CDD:238759 | |||
| fn3 | 1387..1465 | CDD:365830 | |||
| FN3 | 1474..1548 | CDD:214495 | |||
| fn3 | 1567..1645 | CDD:365830 | |||
| fn3 | 1656..1728 | CDD:365830 | |||
| fn3 | 1758..1836 | CDD:365830 | |||
| fn3 | 1849..1926 | CDD:365830 | |||
| fn3 | 1940..2017 | CDD:365830 | |||
| fn3 | 2030..2107 | CDD:365830 | |||
| FN3 | 2120..2199 | CDD:238020 | |||
| fn3 | 2209..2284 | CDD:365830 | |||
| vWA_collagen_alphaI-XII-like | 2324..2488 | CDD:238759 | |||
| TSPN | 2522..2714 | CDD:214560 | |||
| Collagen | 2766..2893 | CDD:189968 | 31/156 (20%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||