DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dyl and Col12a1

DIOPT Version :9

Sequence 1:NP_647890.2 Gene:dyl / 38531 FlyBaseID:FBgn0066365 Length:611 Species:Drosophila melanogaster
Sequence 2:XP_006510860.1 Gene:Col12a1 / 12816 MGIID:88448 Length:3120 Species:Mus musculus


Alignment Length:238 Identity:50/238 - (21%)
Similarity:78/238 - (32%) Gaps:70/238 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   338 CPEPKCGPGLPGGEYGLPQIGANGLSEEYGPPEAYERNDFALGGPGVLPPAAYPDPRHPASDATG 402
            |.:...||..|.|..|.|  ||.|       |......:.|:|.||.......|.|:.|      
Mouse  2743 CTQDSVGPPGPPGPAGGP--GAKG-------PRGERGINGAVGPPGPRGDTGPPGPQGP------ 2792

  Fly   403 AYSENQPDVVPSPQAQTSAAVP--------TADSGTVSGPASSQSPQPQPTGSNELGLPPPPLP- 458
                      |.||.....::|        ..|:|....|..:.:|          |||.||.| 
Mouse  2793 ----------PGPQGPNGLSIPGEQGRQGMKGDAGEPGLPGRTGTP----------GLPGPPGPM 2837

  Fly   459 ------GQSGQYSTVKRKDDLSAGGNLVSLG--------------GRPRSVEGLDDLRGVRRRRD 503
                  |.:|:...:..:......|:..|.|              |||    |...|:|.:..|.
Mouse  2838 GPPGDRGFTGKDGAMGPRGPPGPPGSPGSPGVTGPSGKPGKPGDHGRP----GQSGLKGEKGDRG 2898

  Fly   504 TMDIVVKPQRIYKRNAQEMTDVNTSRIIQVV--APGDVNFALN 544
            .:......:.:.::..:::.....||..|::  .|.|.:.:.|
Mouse  2899 DIASQNMMRAVARQVCEQLISGQMSRFNQMLNQIPNDYHSSRN 2941

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dylNP_647890.2 ZP 90..345 CDD:214579 1/6 (17%)
PHA03378 <339..494 CDD:223065 40/183 (22%)
Col12a1XP_006510860.1 fn3 26..105 CDD:365830
vWA_collagen_alphaI-XII-like 139..302 CDD:238759
fn3 336..415 CDD:365830
vWA_collagen_alphaI-XII-like 439..602 CDD:238759
FN3 634..719 CDD:238020
FN3 724..805 CDD:238020
fn3 817..893 CDD:365830
fn3 906..986 CDD:365830
FN3 1002..1075 CDD:238020
FN3 1090..1176 CDD:238020
vWA_collagen_alphaI-XII-like 1198..1361 CDD:238759
fn3 1387..1465 CDD:365830
FN3 1474..1548 CDD:214495
fn3 1567..1645 CDD:365830
fn3 1656..1728 CDD:365830
fn3 1758..1836 CDD:365830
fn3 1849..1926 CDD:365830
fn3 1940..2017 CDD:365830
fn3 2030..2107 CDD:365830
FN3 2120..2199 CDD:238020
fn3 2209..2284 CDD:365830
vWA_collagen_alphaI-XII-like 2324..2488 CDD:238759
TSPN 2522..2714 CDD:214560
Collagen 2766..2893 CDD:189968 31/156 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.