DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dyl and AgaP_AGAP003317

DIOPT Version :9

Sequence 1:NP_647890.2 Gene:dyl / 38531 FlyBaseID:FBgn0066365 Length:611 Species:Drosophila melanogaster
Sequence 2:XP_319545.5 Gene:AgaP_AGAP003317 / 1279767 VectorBaseID:AGAP003317 Length:339 Species:Anopheles gambiae


Alignment Length:169 Identity:41/169 - (24%)
Similarity:73/169 - (43%) Gaps:25/169 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 LRCTWYDFYEKAVTFRPFQVDMLHAVTANFLGDNLQCWMQIQVGKGPWASEVSGIV--------- 242
            ::|:|:.   :....|..|:.:....|.....|.   :..|..||..:|.:.||.|         
Mosquito     2 VKCSWHG---QRTEERSVQLAVRVHKTLELADDK---FYVITCGKTGFARDDSGAVALKFLDSTG 60

  Fly   243 -KIGQTM-----TMVLAIKDDENKFDMLVRNCVAHDGKRAPIQLVDQNGCVVRPKIMSKFQKIKN 301
             ::.:|:     |:...:.:....:.:.|:||.|.:.|...:.|:|..||.::...|::|:...:
Mosquito    61 RRVRETVYNREYTIKAEVTNPNGTYGIRVKNCFAFNKKNMSVALIDDRGCPLKNDTMTRFRTSAD 125

  Fly   302 FGPSASVVSFAYFQAFKFPDSMNVHFQCVIQVCRYNCPE 340
             |.||:.   .....|||.:...|||||.:..|...|||
Mosquito   126 -GTSATA---QIMSMFKFSEGSEVHFQCDVVQCNGRCPE 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dylNP_647890.2 ZP 90..345 CDD:214579 41/169 (24%)
PHA03378 <339..494 CDD:223065 2/2 (100%)
AgaP_AGAP003317XP_319545.5 Zona_pellucida <63..159 CDD:278526 25/99 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.