DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dyl and AgaP_AGAP005350

DIOPT Version :9

Sequence 1:NP_647890.2 Gene:dyl / 38531 FlyBaseID:FBgn0066365 Length:611 Species:Drosophila melanogaster
Sequence 2:XP_315362.4 Gene:AgaP_AGAP005350 / 1276057 VectorBaseID:AGAP005350 Length:398 Species:Anopheles gambiae


Alignment Length:293 Identity:70/293 - (23%)
Similarity:105/293 - (35%) Gaps:89/293 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 MRVNIEFDRPFY--------GMIFSKGFYSDPHCVHLKPGTGHLSATFEIFLNS---CGMTSSAN 149
            |||::......:        ||   || |.||.|   ||......|.||:.|.:   ||:|...|
Mosquito     1 MRVDVALPSENFSSEAVYLDGM---KG-YPDPKC---KPTIRENLAVFELSLTNIYDCGVTRVIN 58

  Fly   150 HNAAGYGAPTPSGSYV-ENTIIIQYDPYVQEVWDQARKLRCTWYDFYEKAVTFRPFQVDMLHAVT 213
            .         .:|..| .:.||::..|      |..:::...      |.:|..| ..::.|.:.
Mosquito    59 Q---------ITGKKVFYHRIIVETGP------DTGKEIVSV------KCITTGP-SYNVTHGIV 101

  Fly   214 ANFLGDNLQCWMQIQVGKGPWASEV-SGIVKIGQTMTMVLAIKDDENKFDMLVRNCV-----AH- 271
            ..   |.|....|     .|...|: :.|.:.....::.:||:..    |.||...:     || 
Mosquito   102 KR---DVLPAGFQ-----EPEDLEITTSITENAPEPSLGIAIRQG----DKLVSGDLNVSPGAHL 154

  Fly   272 ------DGKRAPI-----------------QLVDQNGCVVRPKIMSKFQKIKNFGPSASVVSFAY 313
                  |.:.|||                 :.:..|||.|.|.:      .:||......:..|.
Mosquito   155 QMEIFLDNRSAPIYGLGVNYMLVTDTKYQEETIIFNGCSVDPYL------FENFNTVDGDLLAAK 213

  Fly   314 FQAFKFPDSMNVHFQCVIQVCRYNCPEPKCGPG 346
            |:|||||:|..|.|:..:.||...|....|..|
Mosquito   214 FRAFKFPESTYVQFRGTVNVCVDRCKGVICSNG 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dylNP_647890.2 ZP 90..345 CDD:214579 69/290 (24%)
PHA03378 <339..494 CDD:223065 2/8 (25%)
AgaP_AGAP005350XP_315362.4 ZP 4..244 CDD:214579 65/286 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.