DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dyl and AgaP_AGAP003012

DIOPT Version :9

Sequence 1:NP_647890.2 Gene:dyl / 38531 FlyBaseID:FBgn0066365 Length:611 Species:Drosophila melanogaster
Sequence 2:XP_311867.4 Gene:AgaP_AGAP003012 / 1272942 VectorBaseID:AGAP003012 Length:695 Species:Anopheles gambiae


Alignment Length:382 Identity:89/382 - (23%)
Similarity:143/382 - (37%) Gaps:117/382 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 HIESAALPLEHRAGYGP--------PAPIYGAPQGPLSTGATNDVSEEA---WPLA-STNDSPQI 84
            |::..:||      .||        |....|.|.|..........|.:|   .|:. .|.:.|.:
Mosquito   280 HLDHKSLP------DGPSTYLNGERPLIDVGEPSGDYFENICEKQSNQAENTLPVVFDTVEDPAV 338

  Fly    85 KHL----------------QVQCEKTHMRVNIEFDRPFYGMIFSKGFYSDPHCVHLKPGTGHL-- 131
            .:|                .|.|:.|.:.|.:..::||.|.|::.|          :..|.::  
Mosquito   339 NNLTRNDANCDKTGTCYDVSVHCKDTRIAVQVRTNKPFNGRIYALG----------RSETCNIDV 393

  Fly   132 --SATFEIFLNSCGM---TSSANHNAAGYGAPTPSGSYVENTIIIQYDPYVQEVWDQARKLRCTW 191
              |.||.:.|...|.   |.||            :|.| .||:::|:...|....|:..|::|| 
Mosquito   394 INSDTFRLDLTMGGQDCNTQSA------------TGIY-SNTVVLQHHSVVMTKADKIYKVKCT- 444

  Fly   192 YDFYEKAVTFRPFQV---DMLHAVTANFLGDNLQCWMQIQVGKGP------------WASEVSGI 241
            ||...|.::|....:   :|:|                  :...|            .|.||. .
Mosquito   445 YDMSSKNISFGMLPIRDPEMIH------------------INSSPEAPPPRIRILDARAREVE-T 490

  Fly   242 VKIGQTMTMVLAIKDDENKFDMLVRNCV--AHDGKRAPIQLVDQNGCVVRPKIMSKFQKIKNFGP 304
            |:||..:|..:.|.:| ..:.:..|:||  |.|.| :..|::|.:||.|.|.|...|.:..|...
Mosquito   491 VRIGDRLTFRIEIPED-TPYGIFARSCVAMAKDSK-STFQIIDDDGCPVDPTIFPAFTQDGNALQ 553

  Fly   305 SASVVSFAYFQAFKFPDSMNVHFQCVIQVCRYNCPEPKCGPGLPGGEYGLPQIGANG 361
            |       .::||:|.:|..|.|||.::.|...|....|       |:|...:.:.|
Mosquito   554 S-------IYEAFRFTESYGVIFQCNVKYCLGPCEPAVC-------EWGRDSVESWG 596

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dylNP_647890.2 ZP 90..345 CDD:214579 70/278 (25%)
PHA03378 <339..494 CDD:223065 4/23 (17%)
AgaP_AGAP003012XP_311867.4 PAN_4 35..86 CDD:290993
PAN_AP_HGF 119..199 CDD:238532
PAN_1 224..315 CDD:278453 9/40 (23%)
ZP 360..576 CDD:214579 67/267 (25%)
Zona_pellucida <490..583 CDD:278526 32/101 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X161
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.