DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dyl and AgaP_AGAP006705

DIOPT Version :9

Sequence 1:NP_647890.2 Gene:dyl / 38531 FlyBaseID:FBgn0066365 Length:611 Species:Drosophila melanogaster
Sequence 2:XP_309038.2 Gene:AgaP_AGAP006705 / 1270352 VectorBaseID:AGAP006705 Length:576 Species:Anopheles gambiae


Alignment Length:340 Identity:98/340 - (28%)
Similarity:181/340 - (53%) Gaps:20/340 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VHGDASHIESAALPLEH-RAGYGPPAPIYGAPQGPLSTGATNDVSEEAWPLASTNDSPQIKHLQV 89
            |...:.:|...||...| |.   ||.|:||   |.:......|..:..:......::.:::|::.
Mosquito   154 VSDTSGYIPLTALQSSHPRL---PPPPVYG---GDIDAAWRPDPWDRDYNRRYRFNNTRVQHIEA 212

  Fly    90 QCEKTHMRVNIEFDRPFYGMIFSKGFYSDPHCVHLKPGTGHLSATFEIFLNSCGMTSSANHNAAG 154
            :|:..:|::.|.|:..|.|:::|.|:..||.|:::. |:|.....|.|.||.||   :...||.|
Mosquito   213 ECQDDYMKIRIGFNGSFNGLLYSSGYAYDPDCMYIN-GSGRDYYEFFIQLNRCG---TLGKNAIG 273

  Fly   155 YGA-PTPSGSYVENTIIIQYDPYVQEVWDQARKLRCTW-YDFYEKAVTFRPFQVDMLHAVTANFL 217
            ..: ..|:.:::.||:.:||:|.::|.:|:..|:.|.: |||: |.|||....|::.......|.
Mosquito   274 EDSRKNPTKNFMWNTVTVQYNPLIEEEFDEHFKVTCEYGYDFW-KTVTFPFLDVEVATGNPVVFT 337

  Fly   218 GDNLQCWMQIQVGKGPWASEVSGIVKIGQTMTMVLAIKDDENKFDMLVRNCVAHDGKRAPIQLVD 282
            ....:|:|:|:.|.|...:.|:|.|::|..:|:::.::...:.||::|.:|.||:|....|||:|
Mosquito   338 LSPPECYMEIRNGYGTNGARVTGPVRVGDPLTLIIYMRSKYDGFDIVVNDCFAHNGANKRIQLID 402

  Fly   283 QNGCVVRPKIMSKFQ-KIKNFGPSASVVSFAYFQAFKFPDSMNVHFQCVIQVCRYNCPEPKCG-- 344
            :.||.|..|::|:|: ...:.|...:.| :||.:.|:|..|..::.:|.:::|...||...|.  
Mosquito   403 EYGCPVDDKLISRFRGSWSDTGVFETQV-YAYMKTFRFTGSPALYIECDVRMCHGRCPSQPCHWR 466

  Fly   345 --PGLPGGEYGLPQI 357
              .|:...|...||:
Mosquito   467 NLKGVTKREAVQPQV 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dylNP_647890.2 ZP 90..345 CDD:214579 80/261 (31%)
PHA03378 <339..494 CDD:223065 6/23 (26%)
AgaP_AGAP006705XP_309038.2 ZP 213..464 CDD:214579 79/256 (31%)
Zona_pellucida <362..463 CDD:278526 31/101 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.