DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dyl and AgaP_AGAP007051

DIOPT Version :9

Sequence 1:NP_647890.2 Gene:dyl / 38531 FlyBaseID:FBgn0066365 Length:611 Species:Drosophila melanogaster
Sequence 2:XP_308712.4 Gene:AgaP_AGAP007051 / 1270050 VectorBaseID:AGAP007051 Length:433 Species:Anopheles gambiae


Alignment Length:310 Identity:74/310 - (23%)
Similarity:129/310 - (41%) Gaps:81/310 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 LQVQCEKTHMRVNIEFDRP------FYGMIFSKGFYSDPHCV---HLKPGTGHLSATFEIFLNSC 142
            :::||:...|.:.|: |.|      |.||::.||...:..|:   |.:.|    ...:::.|.||
Mosquito    41 VRIQCQSGSMLITIK-DAPANLNGQFSGMVYPKGLAKNSTCLTEYHEQEG----PLRYKLPLKSC 100

  Fly   143 GMTSSANHNAAGYGAPTPSGSYVENTIIIQYDPYVQEVWDQAR--KLRCTWYDFYE---KAVTFR 202
            ........:         .|....|||::|  |:::.|.|..|  .:||. |...|   |.|::|
Mosquito   101 NTMPIETED---------GGIEFFNTIVLQ--PHLKLVTDLGRGYHVRCR-YKSREAALKNVSYR 153

  Fly   203 PFQVD---MLHAVTANFLG----------------------DNLQ---------CWMQIQVGKGP 233
            ....|   .|...:|...|                      |..|         |.|:|..|:  
Mosquito   154 HKAADDSRPLALTSAEGAGPDRREHGRSMDSGKDDRAVSGEDGQQQDAGKPMPGCHMKIFTGE-- 216

  Fly   234 WASEVSGIVKIGQTMTMVLAIKDDENKFDMLVRNCVAHDGKR-APIQLVDQNGCVVRPKIMSKFQ 297
               :::..||||..:|:|:.| |.:.::.:.|.:|:..||.. ...:|:...||.:..:|:..|:
Mosquito   217 ---KLAENVKIGDPLTLVINI-DQQEEYGLHVTDCLVRDGLGWGEQKLISDEGCPLDSEILGPFE 277

  Fly   298 KIKNFGPSASVVSFAYFQAFKFPDSMNVHFQCVIQVCRYNCPE----PKC 343
            ...:  .|.:.|:   |.|.|||.:.:|::||.:::|....|:    |.|
Mosquito   278 YTAD--RSKATVT---FPAHKFPYTSSVYYQCNVKLCALKDPDCHKTPTC 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dylNP_647890.2 ZP 90..345 CDD:214579 74/307 (24%)
PHA03378 <339..494 CDD:223065 3/9 (33%)
AgaP_AGAP007051XP_308712.4 ZP 44..323 CDD:214579 74/307 (24%)
Zona_pellucida <221..323 CDD:278526 31/108 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.