| Sequence 1: | NP_647890.2 | Gene: | dyl / 38531 | FlyBaseID: | FBgn0066365 | Length: | 611 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_009291571.1 | Gene: | col12a1a / 100149543 | ZFINID: | ZDB-GENE-090728-1 | Length: | 3112 | Species: | Danio rerio |
| Alignment Length: | 230 | Identity: | 50/230 - (21%) |
|---|---|---|---|
| Similarity: | 74/230 - (32%) | Gaps: | 54/230 - (23%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 338 CPEPKCGPGLPGGEYGLPQI-------------------GANGLSEEYGPPEAYERNDFAL-GGP 382
Fly 383 GVLPPAAYPDPRHPASDATGAYSENQPDVVPSPQAQTSAAVPTADSGTVS--GPASSQSPQPQPT 445
Fly 446 GSNELGLPPPPLPGQSGQYSTVKRKDDLSAGGNLVSLGGRPRSVEGLDDLRGVRRRRDTMDIVVK 510
Fly 511 PQRIYKRNAQEMTDVNTSRIIQVVAPGDVNFALNS 545 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dyl | NP_647890.2 | ZP | 90..345 | CDD:214579 | 1/6 (17%) |
| PHA03378 | <339..494 | CDD:223065 | 40/176 (23%) | ||
| col12a1a | XP_009291571.1 | fn3 | 26..103 | CDD:278470 | |
| vWA_collagen_alphaI-XII-like | 134..297 | CDD:238759 | |||
| fn3 | 331..410 | CDD:278470 | |||
| vWA_collagen_alphaI-XII-like | 434..597 | CDD:238759 | |||
| FN3 | 629..716 | CDD:238020 | |||
| FN3 | 721..807 | CDD:238020 | |||
| fn3 | 812..890 | CDD:278470 | |||
| fn3 | 902..981 | CDD:278470 | |||
| FN3 | 995..1069 | CDD:238020 | |||
| fn3 | 1084..1163 | CDD:278470 | |||
| vWA_collagen_alphaI-XII-like | 1195..1358 | CDD:238759 | |||
| fn3 | 1387..1464 | CDD:278470 | |||
| fn3 | 1475..1556 | CDD:278470 | |||
| FN3 | 1565..1643 | CDD:214495 | |||
| fn3 | 1656..1727 | CDD:278470 | |||
| fn3 | 1754..1830 | CDD:278470 | |||
| fn3 | 1844..1923 | CDD:278470 | |||
| fn3 | 1935..2012 | CDD:278470 | |||
| fn3 | 2025..2105 | CDD:278470 | |||
| FN3 | 2118..2192 | CDD:238020 | |||
| fn3 | 2206..2283 | CDD:278470 | |||
| vWA_collagen_alphaI-XII-like | 2323..2487 | CDD:238759 | |||
| TSPN | 2521..2715 | CDD:214560 | |||
| Collagen | 2766..2845 | CDD:189968 | 19/94 (20%) | ||
| Collagen | 2813..2895 | CDD:189968 | 21/101 (21%) | ||
| Collagen | 2960..>2994 | CDD:189968 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||