DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fdx2 and COX15

DIOPT Version :9

Sequence 1:NP_647889.2 Gene:Fdx2 / 38530 FlyBaseID:FBgn0035529 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_011068.1 Gene:COX15 / 856884 SGDID:S000000943 Length:486 Species:Saccharomyces cerevisiae


Alignment Length:92 Identity:19/92 - (20%)
Similarity:29/92 - (31%) Gaps:34/92 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLVINSCRAASRLALRSLNLRSPIATRTFSTG--------------------LALKTKDVV---- 41
            |..|.......|.|:.||::...:.|...:.|                    |||.|..:|    
Yeast   384 MYAIKKKAVIPRNAMTSLHVMMGVVTLQATLGILTILYLVPISLASIHQAGALALLTSSLVFASQ 448

  Fly    42 ---------NITFVRANGDKIKTSGKV 59
                     |:.....:..|: ||||:
Yeast   449 LRKPRAPMRNVIITLPHSSKV-TSGKI 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fdx2NP_647889.2 fer2 41..144 CDD:412190 7/32 (22%)
COX15NP_011068.1 COX15-CtaA 15..451 CDD:418569 13/66 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R421
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.