DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fdx2 and FED A

DIOPT Version :10

Sequence 1:NP_647889.2 Gene:Fdx2 / 38530 FlyBaseID:FBgn0035529 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_176291.1 Gene:FED A / 842386 AraportID:AT1G60950 Length:148 Species:Arabidopsis thaliana


Alignment Length:123 Identity:32/123 - (26%)
Similarity:45/123 - (36%) Gaps:37/123 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RAASRLALRSL---------NLRSPIATRTFSTGLA-LKTK--------------DVVNITFVRA 48
            |:.:.::||||         .|:|..|.....|.:| .|.|              ||..:.....
plant    18 RSPAPISLRSLPSANTQSLFGLKSGTARGGRVTAMATYKVKFITPEGELEVECDDDVYVLDAAEE 82

  Fly    49 NGDKIKTSGKVG--DSLLDVVVNNNVD------LDGFGACEG-TLTCSTCHLIFKTSD 97
            .|..:..|.:.|  .|....||:.:||      ||.....|| .|||:.    :.|||
plant    83 AGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSFLDDEQIGEGFVLTCAA----YPTSD 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fdx2NP_647889.2 fer2 41..144 CDD:444718 18/66 (27%)
FED ANP_176291.1 PLN03136 1..148 CDD:178681 32/123 (26%)

Return to query results.
Submit another query.