DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fdx2 and AT4G32590

DIOPT Version :10

Sequence 1:NP_647889.2 Gene:Fdx2 / 38530 FlyBaseID:FBgn0035529 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_974664.1 Gene:AT4G32590 / 829394 AraportID:AT4G32590 Length:180 Species:Arabidopsis thaliana


Alignment Length:104 Identity:31/104 - (29%)
Similarity:41/104 - (39%) Gaps:35/104 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 DKIKTSGKVGDSLL-DVVVNNNVDL-DGFGA---CEGTLTCSTCHLIFKTSDFEKLPDKPGDEEL 110
            ||.|...  ||.|| .::.:|.::| ..:|.   |.|..:|.||.:                |.|
plant    76 DKAKAVS--GDKLLRSIMQDNKIELYAAYGKVMNCGGGGSCGTCIV----------------EIL 122

  Fly   111 DMLDLAYELTDTS-----------RLGCQ-ITLSKDMEG 137
            |..||..|.|||.           ||.|| |..:|:..|
plant   123 DGRDLLNERTDTENRYLKKKPESWRLACQTIVGNKENSG 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fdx2NP_647889.2 fer2 41..144 CDD:444718 31/104 (30%)
AT4G32590NP_974664.1 None

Return to query results.
Submit another query.