DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fdx2 and MFDX2

DIOPT Version :9

Sequence 1:NP_647889.2 Gene:Fdx2 / 38530 FlyBaseID:FBgn0035529 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001031685.1 Gene:MFDX2 / 827856 AraportID:AT4G21090 Length:197 Species:Arabidopsis thaliana


Alignment Length:104 Identity:45/104 - (43%)
Similarity:71/104 - (68%) Gaps:2/104 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 VNITFVRANGDKIKTSGKVGDSLLDVVVNNNVDLDGFGACEGTLTCSTCHLIFKTSDFEKLPDKP 105
            :|:|||..:|::|.....||.::|:....|:::|:  |||||:|.|||||:|...:.:....::|
plant    81 INVTFVDKDGEEIHIKVPVGMNILEAAHENDIELE--GACEGSLACSTCHVIVMDTKYYNKLEEP 143

  Fly   106 GDEELDMLDLAYELTDTSRLGCQITLSKDMEGLEVHVPS 144
            .|||.||||||:.||.|||||||:....:::|:.:.:||
plant   144 TDEENDMLDLAFGLTATSRLGCQVIAKPELDGVRLAIPS 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fdx2NP_647889.2 fer2 41..144 CDD:412190 43/102 (42%)
MFDX2NP_001031685.1 PLN02593 81..197 CDD:178203 45/104 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0633
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53940
OrthoDB 1 1.010 - - D1380051at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100695
Panther 1 1.100 - - O PTHR23426
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.