DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fdx2 and fdx1b

DIOPT Version :9

Sequence 1:NP_647889.2 Gene:Fdx2 / 38530 FlyBaseID:FBgn0035529 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001094419.1 Gene:fdx1b / 562135 ZFINID:ZDB-GENE-060526-382 Length:168 Species:Danio rerio


Alignment Length:157 Identity:70/157 - (44%)
Similarity:97/157 - (61%) Gaps:15/157 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RAASRLALRSLNLRS--PIATRTFS----TGLALKTKDVVN--------ITFVRANGDKIKTSGK 58
            |...|:.|||.:|.:  |.:.|:.:    |..:|.::..:|        :.||..:|.|......
Zfish     4 RMCVRVLLRSSSLLACHPGSVRSHAEFHHTVPSLCSQSQLNGSSSSKVLVHFVNQSGVKSSVFVT 68

  Fly    59 VGDSLLDVVVNNNVDLDGFGACEGTLTCSTCHLIFKTSDFEKLPDKPGDEELDMLDLAYELTDTS 123
            .|::|||||:..|:|..|||||||||.||||||||:.:.|:|| :...|||:|||||||.:|.||
Zfish    69 EGETLLDVVIKKNLDFSGFGACEGTLACSTCHLIFEENVFDKL-EPMVDEEIDMLDLAYGITKTS 132

  Fly   124 RLGCQITLSKDMEGLEVHVPSTINDAR 150
            |||||:|:.:.|:|:.|.||..|.|.|
Zfish   133 RLGCQVTVERWMDGMTVRVPQDIKDQR 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fdx2NP_647889.2 fer2 41..144 CDD:412190 56/110 (51%)
fdx1bNP_001094419.1 fer2 51..157 CDD:294106 57/106 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580884
Domainoid 1 1.000 109 1.000 Domainoid score I6308
eggNOG 1 0.900 - - E1_COG0633
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 139 1.000 Inparanoid score I4493
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1380051at2759
OrthoFinder 1 1.000 - - FOG0006407
OrthoInspector 1 1.000 - - otm25699
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23426
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4080
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.860

Return to query results.
Submit another query.