DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fdx2 and Fdx1

DIOPT Version :9

Sequence 1:NP_647889.2 Gene:Fdx2 / 38530 FlyBaseID:FBgn0035529 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001189075.1 Gene:Fdx1 / 39070 FlyBaseID:FBgn0011769 Length:172 Species:Drosophila melanogaster


Alignment Length:149 Identity:53/149 - (35%)
Similarity:85/149 - (57%) Gaps:11/149 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VINSCRAASRLALR--------SLNLRSPIATRTFSTGLALKTKDVVNITFVRANGDKIKTSGKV 59
            |.|||:..|:...:        :|:...|.....|.......|.::||||:|..:|.:.|..|||
  Fly    11 VHNSCKLISKQIAKPAFYTPHNALHTTIPRRHGEFEWQDPKSTDEIVNITYVDKDGKRTKVQGKV 75

  Fly    60 GDSLLDVVVNNNVDLDGFGACEGTLTCSTCHLIFKTSDFEKLPDKPGDEELDMLDLAYELTDTSR 124
            ||::|.:...:.::::  ||||.:|.|:|||:..:....:||.:.. ::|.|:||:|..|.:.||
  Fly    76 GDNVLYLAHRHGIEME--GACEASLACTTCHVYVQHDYLQKLKEAE-EQEDDLLDMAPFLRENSR 137

  Fly   125 LGCQITLSKDMEGLEVHVP 143
            |||||.|.|.|||:|:.:|
  Fly   138 LGCQILLDKSMEGMELELP 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fdx2NP_647889.2 fer2 41..144 CDD:412190 44/103 (43%)
Fdx1NP_001189075.1 PLN02593 57..172 CDD:178203 44/103 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438638
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0633
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I396
Isobase 1 0.950 - 0 Normalized mean entropy S1416
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D137025at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm51416
orthoMCL 1 0.900 - - OOG6_100695
Panther 1 1.100 - - P PTHR23426
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R421
SonicParanoid 00.000 Not matched by this tool.
109.780

Return to query results.
Submit another query.