DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fdx2 and Fdx2

DIOPT Version :9

Sequence 1:NP_647889.2 Gene:Fdx2 / 38530 FlyBaseID:FBgn0035529 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001101472.1 Gene:Fdx2 / 313786 RGDID:1561264 Length:174 Species:Rattus norvegicus


Alignment Length:152 Identity:60/152 - (39%)
Similarity:84/152 - (55%) Gaps:17/152 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SCRAASRLALRSLNLR---SPIATRTF-STGLALK----------TKDVVNITFVRANGDKIKTS 56
            |.|...|.|..|...|   :.:.:||| |||....          .:||||:.||..:|.:|...
  Rat    10 SARVLLRAAGGSWGPRAGHAAVTSRTFGSTGERRAGEDEADSPELPRDVVNVVFVDRSGKRIPVR 74

  Fly    57 GKVGDSLLDVVVNNNVDLDGFGACEGTLTCSTCHLIFKTSDFEKLPDKPGDEELDMLDLAYELTD 121
            |:|||::|.:...:.|||:  ||||.:|.|||||:....:..:.|| .|.:.|.||||:|..|.:
  Rat    75 GRVGDNVLHLAQRHGVDLE--GACEASLACSTCHVYVSEAHLDLLP-PPEEREDDMLDMAPLLQE 136

  Fly   122 TSRLGCQITLSKDMEGLEVHVP 143
            .|||||||.|:.::||.|..:|
  Rat   137 NSRLGCQIVLTPELEGAEFALP 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fdx2NP_647889.2 fer2 41..144 CDD:412190 46/103 (45%)
Fdx2NP_001101472.1 PLN02593 59..174 CDD:178203 40/89 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0633
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53940
OrthoDB 1 1.010 - - D1380051at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100695
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.730

Return to query results.
Submit another query.