DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fdx2 and Fdx1

DIOPT Version :9

Sequence 1:NP_647889.2 Gene:Fdx2 / 38530 FlyBaseID:FBgn0035529 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_058822.2 Gene:Fdx1 / 29189 RGDID:62036 Length:188 Species:Rattus norvegicus


Alignment Length:114 Identity:66/114 - (57%)
Similarity:84/114 - (73%) Gaps:1/114 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 TKDVVNITFVRANGDKIKTSGKVGDSLLDVVVNNNVDLDGFGACEGTLTCSTCHLIFKTSDFEKL 101
            ::|.|.:.|...:|:.:.|.|||||||||||:.||:|:||||||||||.||||||||:...:|||
  Rat    67 SEDKVTVHFKNRDGETLTTKGKVGDSLLDVVIENNLDIDGFGACEGTLACSTCHLIFEDHIYEKL 131

  Fly   102 PDKPGDEELDMLDLAYELTDTSRLGCQITLSKDMEGLEVHVPSTINDAR 150
             |...|||.||||||:.||:.||||||:.|:|.|:.:.|.||..:.|.|
  Rat   132 -DAITDEENDMLDLAFGLTNRSRLGCQVCLTKAMDNMTVRVPEAVADVR 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fdx2NP_647889.2 fer2 41..144 CDD:412190 62/102 (61%)
Fdx1NP_058822.2 fer2 71..174 CDD:412190 63/103 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 115 1.000 Domainoid score I5898
eggNOG 1 0.900 - - E1_COG0633
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31216
Inparanoid 1 1.050 135 1.000 Inparanoid score I4470
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1380051at2759
OrthoFinder 1 1.000 - - FOG0006407
OrthoInspector 1 1.000 - - oto98052
orthoMCL 1 0.900 - - OOG6_100695
Panther 1 1.100 - - LDO PTHR23426
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4080
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.830

Return to query results.
Submit another query.