DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fdx2 and etp1

DIOPT Version :9

Sequence 1:NP_647889.2 Gene:Fdx2 / 38530 FlyBaseID:FBgn0035529 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_594836.2 Gene:etp1 / 2541839 PomBaseID:SPAC22E12.10c Length:616 Species:Schizosaccharomyces pombe


Alignment Length:86 Identity:38/86 - (44%)
Similarity:58/86 - (67%) Gaps:5/86 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 DVVVNNNVDLDGFGACEGTLTCSTCHLIFKTSDFEKLPDKPGDEELDMLDLAYELTDTSRLGCQI 129
            ::::..|.:    |||||::.|||||:|.....:|.| |.|.::|.||||||:.|.:|||||||:
pombe   530 EIMIEGNEE----GACEGSVACSTCHVIVDPEHYELL-DPPEEDEEDMLDLAFGLEETSRLGCQV 589

  Fly   130 TLSKDMEGLEVHVPSTINDAR 150
            .|.||::|:.|.:|:...:.|
pombe   590 LLRKDLDGIRVRIPAQTRNIR 610

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fdx2NP_647889.2 fer2 41..144 CDD:412190 36/78 (46%)
etp1NP_594836.2 PTZ00127 35..464 CDD:240283
COX15-CtaA 99..458 CDD:280746
fer2 519..608 CDD:294106 37/82 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 66 1.000 Domainoid score I2800
eggNOG 1 0.900 - - E1_COG0633
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R421
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.