DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fdx2 and FDX1

DIOPT Version :9

Sequence 1:NP_647889.2 Gene:Fdx2 / 38530 FlyBaseID:FBgn0035529 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_004100.1 Gene:FDX1 / 2230 HGNCID:3638 Length:184 Species:Homo sapiens


Alignment Length:149 Identity:80/149 - (53%)
Similarity:100/149 - (67%) Gaps:10/149 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RAASRLALRSLNLRSPIATRTFSTGLAL------KTKDVVNITFVRANGDKIKTSGKVGDSLLDV 66
            ||.|...||:   |.|..:...|..|::      .::|.:.:.|:..:|:.:.|.||||||||||
Human    31 RAGSSGLLRN---RGPGGSAEASRSLSVSARARSSSEDKITVHFINRDGETLTTKGKVGDSLLDV 92

  Fly    67 VVNNNVDLDGFGACEGTLTCSTCHLIFKTSDFEKLPDKPGDEELDMLDLAYELTDTSRLGCQITL 131
            ||.||:|:||||||||||.||||||||:...:||| |...|||.|||||||.|||.|||||||.|
Human    93 VVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKL-DAITDEENDMLDLAYGLTDRSRLGCQICL 156

  Fly   132 SKDMEGLEVHVPSTINDAR 150
            :|.|:.:.|.||.|:.|||
Human   157 TKSMDNMTVRVPETVADAR 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fdx2NP_647889.2 fer2 41..144 CDD:412190 65/102 (64%)
FDX1NP_004100.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 35..57 6/24 (25%)
fer2 67..168 CDD:320788 64/101 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 119 1.000 Domainoid score I5817
eggNOG 1 0.900 - - E1_COG0633
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31216
Inparanoid 1 1.050 147 1.000 Inparanoid score I4421
Isobase 1 0.950 - 0 Normalized mean entropy S1416
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1380051at2759
OrthoFinder 1 1.000 - - FOG0006407
OrthoInspector 1 1.000 - - oto90956
orthoMCL 1 0.900 - - OOG6_100695
Panther 1 1.100 - - LDO PTHR23426
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R421
SonicParanoid 1 1.000 - - X4080
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.810

Return to query results.
Submit another query.