DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fdx2 and Y73F8A.27

DIOPT Version :9

Sequence 1:NP_647889.2 Gene:Fdx2 / 38530 FlyBaseID:FBgn0035529 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_502861.1 Gene:Y73F8A.27 / 178434 WormBaseID:WBGene00013532 Length:169 Species:Caenorhabditis elegans


Alignment Length:152 Identity:59/152 - (38%)
Similarity:87/152 - (57%) Gaps:22/152 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RLALRSLNLRS--------PIATRTFSTGLALKTKD-----------VVNITFVRANGDKIKTSG 57
            |||:|:.....        |:..|.|.|....||.|           |||||:|..:|.:.|..|
 Worm     6 RLAMRAKGFSRFLAETQAFPVKNRHFMTSSVRKTGDFEYEDPKSEDEVVNITYVLRDGTERKIRG 70

  Fly    58 KVGDSLLDVVVNNNVDLDGFGACEGTLTCSTCHLIFKTSDFEKLPDKPGDEELDMLDLAYELTDT 122
            ||||:::.:....:::::  ||||.:|.|||||:....:...|||: |.:||.||||:|..|.|.
 Worm    71 KVGDNVMFLAHRYDIEME--GACEASLACSTCHVYVDPAFQNKLPE-PLEEEDDMLDMAPALKDN 132

  Fly   123 SRLGCQITLSKDMEGLEVHVPS 144
            |||||||.|:|:::|:.|.:|:
 Worm   133 SRLGCQIVLTKELDGITVTLPT 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fdx2NP_647889.2 fer2 41..144 CDD:412190 46/102 (45%)
Y73F8A.27NP_502861.1 PLN02593 54..169 CDD:178203 47/104 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0633
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1416
OMA 1 1.010 - - QHG53940
OrthoDB 1 1.010 - - D1380051at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100695
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R421
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.710

Return to query results.
Submit another query.