DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fdx2 and FDX2

DIOPT Version :9

Sequence 1:NP_647889.2 Gene:Fdx2 / 38530 FlyBaseID:FBgn0035529 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001026904.2 Gene:FDX2 / 112812 HGNCID:30546 Length:186 Species:Homo sapiens


Alignment Length:105 Identity:49/105 - (46%)
Similarity:68/105 - (64%) Gaps:3/105 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 DVVNITFVRANGDKIKTSGKVGDSLLDVVVNNNVDLDGFGACEGTLTCSTCHLIFKTSDFEKLPD 103
            ||||:.||..:|.:|..||:|||::|.:...:.|||:  ||||.:|.|||||:.......:.|| 
Human    69 DVVNVVFVDRSGQRIPVSGRVGDNVLHLAQRHGVDLE--GACEASLACSTCHVYVSEDHLDLLP- 130

  Fly   104 KPGDEELDMLDLAYELTDTSRLGCQITLSKDMEGLEVHVP 143
            .|.:.|.||||:|..|.:.|||||||.|:.::||.|..:|
Human   131 PPEEREDDMLDMAPLLQENSRLGCQIVLTPELEGAEFTLP 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fdx2NP_647889.2 fer2 41..144 CDD:412190 47/103 (46%)
FDX2NP_001026904.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..67
PLN02593 71..186 CDD:178203 47/103 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0633
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1416
OMA 1 1.010 - - QHG53940
OrthoDB 1 1.010 - - D1380051at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100695
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R421
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.710

Return to query results.
Submit another query.