DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fdx2 and fdx1

DIOPT Version :9

Sequence 1:NP_647889.2 Gene:Fdx2 / 38530 FlyBaseID:FBgn0035529 Length:152 Species:Drosophila melanogaster
Sequence 2:XP_002938002.1 Gene:fdx1 / 100379765 XenbaseID:XB-GENE-990886 Length:167 Species:Xenopus tropicalis


Alignment Length:162 Identity:83/162 - (51%)
Similarity:101/162 - (62%) Gaps:12/162 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLVINSCRAASRLALRSLNLRSPIATRTF----STGL------ALKTKDVVNITFVRANGDKIKT 55
            |...|.....||..|.|..|..| |.||.    |:.|      |..::|.|.:.|:..:|:.:..
 Frog     1 MAAANKLLGISRCLLGSSRLGVP-AVRTVMCPRSSRLGPGHIRAFSSEDKVTVKFINRDGETLVA 64

  Fly    56 SGKVGDSLLDVVVNNNVDLDGFGACEGTLTCSTCHLIFKTSDFEKLPDKPGDEELDMLDLAYELT 120
            .||||:|||||||..|:|:||||||||||.||||||||:...|::| |...|||:|||||||.||
 Frog    65 QGKVGESLLDVVVEKNLDIDGFGACEGTLACSTCHLIFEDHIFQQL-DPITDEEMDMLDLAYGLT 128

  Fly   121 DTSRLGCQITLSKDMEGLEVHVPSTINDARAA 152
            |||||||||.|.|.|.|:.|.||.::.|.|.|
 Frog   129 DTSRLGCQICLKKSMNGMTVKVPESVADVRQA 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fdx2NP_647889.2 fer2 41..144 CDD:412190 64/102 (63%)
fdx1XP_002938002.1 fer2 50..162 CDD:381830 68/112 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 116 1.000 Domainoid score I5892
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31216
Inparanoid 1 1.050 144 1.000 Inparanoid score I4346
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1380051at2759
OrthoFinder 1 1.000 - - FOG0006407
OrthoInspector 1 1.000 - - otm49070
Panther 1 1.100 - - LDO PTHR23426
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R421
SonicParanoid 1 1.000 - - X4080
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.100

Return to query results.
Submit another query.