DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fdx2 and fdx2

DIOPT Version :9

Sequence 1:NP_647889.2 Gene:Fdx2 / 38530 FlyBaseID:FBgn0035529 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001120210.1 Gene:fdx2 / 100145258 XenbaseID:XB-GENE-5933678 Length:193 Species:Xenopus tropicalis


Alignment Length:107 Identity:47/107 - (43%)
Similarity:72/107 - (67%) Gaps:3/107 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 TKDVVNITFVRANGDKIKTSGKVGDSLLDVVVNNNVDLDGFGACEGTLTCSTCHLIFKTSDFEKL 101
            :::.|::.||..:|.::...||||:|:|.:....|:||:  ||||.:|.|||||:...|..|:||
 Frog    74 SEETVDVVFVDRSGQRVPVKGKVGESVLCLAHRCNIDLE--GACESSLACSTCHVYVNTEFFDKL 136

  Fly   102 PDKPGDEELDMLDLAYELTDTSRLGCQITLSKDMEGLEVHVP 143
            |: |.:.|.||||:|..|.:.|||||||.|::::.|.|..:|
 Frog   137 PE-PDEREDDMLDMAPLLQENSRLGCQIILTEELNGAEFTLP 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fdx2NP_647889.2 fer2 41..144 CDD:412190 47/103 (46%)
fdx2NP_001120210.1 PLN02593 78..193 CDD:178203 47/103 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1380051at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.