DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15012 and AT1G36980

DIOPT Version :9

Sequence 1:NP_001163347.1 Gene:CG15012 / 38529 FlyBaseID:FBgn0035528 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001319157.1 Gene:AT1G36980 / 840608 AraportID:AT1G36980 Length:135 Species:Arabidopsis thaliana


Alignment Length:123 Identity:38/123 - (30%)
Similarity:65/123 - (52%) Gaps:2/123 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 AGLLFFAGWWVLIDAMSIDGKHQITTGHVFIGIFGTISFCMVNAVKGEHISDENSSESGARIAKI 89
            :|.:|..|||..:||: :....|:...|...|||.::...|.|.|:.|.| |.:..:.|....|:
plant    15 SGAVFGTGWWFWVDAV-VCSSIQVPFVHYLPGIFASLGALMFNCVRKEDI-DYSPYDEGEWRLKL 77

  Fly    90 WLLVGFLMGFASIIAAIWVMIDDFINNEKKDGWFGVALLMQNVFILFASLVYKFGRNE 147
            ||.:.:::.|.|:.|::.::|.|.:.......|.|||.:.|.||:|.:.|:|....:|
plant    78 WLFIAYVVAFVSLAASVGLLIQDSVVKTGPSTWTGVAGVFQCVFVLISGLMYWTSHSE 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15012NP_001163347.1 UPF0220 9..150 CDD:283030 38/123 (31%)
AT1G36980NP_001319157.1 UPF0220 14..134 CDD:398773 37/120 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 71 1.000 Domainoid score I3377
eggNOG 1 0.900 - - E1_KOG3393
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 70 1.000 Inparanoid score I2465
OMA 1 1.010 - - QHG54488
OrthoDB 1 1.010 - - D1422977at2759
OrthoFinder 1 1.000 - - FOG0003332
OrthoInspector 1 1.000 - - oto2973
orthoMCL 1 0.900 - - OOG6_102597
Panther 1 1.100 - - LDO PTHR13180
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.