DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15012 and AT1G36980

DIOPT Version :10

Sequence 1:NP_001163347.1 Gene:CG15012 / 38529 FlyBaseID:FBgn0035528 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_564477.1 Gene:AT1G36980 / 840608 AraportID:AT1G36980 Length:135 Species:Arabidopsis thaliana


Alignment Length:123 Identity:38/123 - (30%)
Similarity:65/123 - (52%) Gaps:2/123 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 AGLLFFAGWWVLIDAMSIDGKHQITTGHVFIGIFGTISFCMVNAVKGEHISDENSSESGARIAKI 89
            :|.:|..|||..:||: :....|:...|...|||.::...|.|.|:.|.| |.:..:.|....|:
plant    15 SGAVFGTGWWFWVDAV-VCSSIQVPFVHYLPGIFASLGALMFNCVRKEDI-DYSPYDEGEWRLKL 77

  Fly    90 WLLVGFLMGFASIIAAIWVMIDDFINNEKKDGWFGVALLMQNVFILFASLVYKFGRNE 147
            ||.:.:::.|.|:.|::.::|.|.:.......|.|||.:.|.||:|.:.|:|....:|
plant    78 WLFIAYVVAFVSLAASVGLLIQDSVVKTGPSTWTGVAGVFQCVFVLISGLMYWTSHSE 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15012NP_001163347.1 UPF0220 9..150 CDD:428395 38/123 (31%)
AT1G36980NP_564477.1 UPF0220 14..134 CDD:428395 37/120 (31%)

Return to query results.
Submit another query.