DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15012 and Tmem50b

DIOPT Version :9

Sequence 1:NP_001163347.1 Gene:CG15012 / 38529 FlyBaseID:FBgn0035528 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_084294.1 Gene:Tmem50b / 77975 MGIID:1925225 Length:158 Species:Mus musculus


Alignment Length:144 Identity:58/144 - (40%)
Similarity:90/144 - (62%) Gaps:10/144 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DASRNRNT--SIIAGLLFFAGWWVLIDAMSIDGKHQITTGHVF--IGIFGTISFCMVNAVKGEHI 74
            |.|..|||  |::||:|||.|||::|||..:..|.: ...|.|  .|:|.|::|.|:|||....:
Mouse    17 DWSERRNTVASVVAGILFFTGWWIMIDAAVVYPKPE-QLNHAFHTCGVFSTLAFFMINAVSNAQV 80

  Fly    75 SDENSSESGA---RIAKIWLLVGFLMGFASIIAAIWVMIDDFINNEKKDGWFGVALLMQNVFILF 136
            ..: |.|||.   ..|::||.:||::.|.|:||::|::...:: .:..|.:.|:|:..||..|.|
Mouse    81 RGD-SYESGCLGRTGARVWLFIGFMLMFGSLIASMWILFGAYV-TQNIDVYPGLAVFFQNALIFF 143

  Fly   137 ASLVYKFGRNEEEW 150
            ::|:|||||.||.|
Mouse   144 STLIYKFGRTEELW 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15012NP_001163347.1 UPF0220 9..150 CDD:283030 57/142 (40%)
Tmem50bNP_084294.1 UPF0220 9..157 CDD:398773 57/142 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843298
Domainoid 1 1.000 111 1.000 Domainoid score I6249
eggNOG 1 0.900 - - E1_KOG3393
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 114 1.000 Inparanoid score I4826
Isobase 1 0.950 - 0 Normalized mean entropy S3414
OMA 1 1.010 - - QHG54488
OrthoDB 1 1.010 - - D1422977at2759
OrthoFinder 1 1.000 - - FOG0003332
OrthoInspector 1 1.000 - - otm44181
orthoMCL 1 0.900 - - OOG6_102597
Panther 1 1.100 - - O PTHR13180
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5750
SonicParanoid 1 1.000 - - X2700
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1716.750

Return to query results.
Submit another query.