DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15012 and TMEM50B

DIOPT Version :9

Sequence 1:NP_001163347.1 Gene:CG15012 / 38529 FlyBaseID:FBgn0035528 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_006125.2 Gene:TMEM50B / 757 HGNCID:1280 Length:158 Species:Homo sapiens


Alignment Length:144 Identity:57/144 - (39%)
Similarity:89/144 - (61%) Gaps:10/144 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DASRNRN--TSIIAGLLFFAGWWVLIDAMSIDGKHQITTGHVF--IGIFGTISFCMVNAVKGEHI 74
            |.|..||  .|::||:|||.|||::|||..:..|.: ...|.|  .|:|.|::|.|:|||....:
Human    17 DWSERRNAVASVVAGILFFTGWWIMIDAAVVYPKPE-QLNHAFHTCGVFSTLAFFMINAVSNAQV 80

  Fly    75 SDENSSESGA---RIAKIWLLVGFLMGFASIIAAIWVMIDDFINNEKKDGWFGVALLMQNVFILF 136
            ..: |.|||.   ..|::||.:||::.|.|:||::|::...:: .:..|.:.|:|:..||..|.|
Human    81 RGD-SYESGCLGRTGARVWLFIGFMLMFGSLIASMWILFGAYV-TQNTDVYPGLAVFFQNALIFF 143

  Fly   137 ASLVYKFGRNEEEW 150
            ::|:|||||.||.|
Human   144 STLIYKFGRTEELW 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15012NP_001163347.1 UPF0220 9..150 CDD:283030 56/142 (39%)
TMEM50BNP_006125.2 UPF0220 9..157 CDD:398773 56/142 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153196
Domainoid 1 1.000 111 1.000 Domainoid score I6246
eggNOG 1 0.900 - - E1_KOG3393
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 114 1.000 Inparanoid score I4839
Isobase 1 0.950 - 0 Normalized mean entropy S3414
OMA 1 1.010 - - QHG54488
OrthoDB 1 1.010 - - D1422977at2759
OrthoFinder 1 1.000 - - FOG0003332
OrthoInspector 1 1.000 - - otm42125
orthoMCL 1 0.900 - - OOG6_102597
Panther 1 1.100 - - O PTHR13180
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5750
SonicParanoid 1 1.000 - - X2700
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.750

Return to query results.
Submit another query.