DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15012 and Tmem50a

DIOPT Version :9

Sequence 1:NP_001163347.1 Gene:CG15012 / 38529 FlyBaseID:FBgn0035528 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_082211.1 Gene:Tmem50a / 71817 MGIID:1919067 Length:157 Species:Mus musculus


Alignment Length:142 Identity:57/142 - (40%)
Similarity:84/142 - (59%) Gaps:5/142 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DASRNRNT--SIIAGLLFFAGWWVLID-AMSIDGKHQITTGHVFIGIFGTISFCMVNAVKGEHIS 75
            |....|||  ||.||:|||.|||::|| |:......|....:...|:..||:|.|:|||....:.
Mouse    15 DWGEKRNTIASIAAGVLFFTGWWIIIDAAVMYPRMDQFNHSYHTCGVIATIAFLMINAVSNGQVR 79

  Fly    76 DENSSES--GARIAKIWLLVGFLMGFASIIAAIWVMIDDFINNEKKDGWFGVALLMQNVFILFAS 138
            .::.||.  |...|:|||.:||::.|.|:||::|::...::..||...:.|:|:..||.||.|..
Mouse    80 GDSYSEGCLGQTGARIWLFIGFMLAFGSLIASMWILFGGYVAKEKDVVYPGIAVFFQNAFIFFGG 144

  Fly   139 LVYKFGRNEEEW 150
            ||:||||.|:.|
Mouse   145 LVFKFGRTEDLW 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15012NP_001163347.1 UPF0220 9..150 CDD:283030 56/140 (40%)
Tmem50aNP_082211.1 UPF0220 8..156 CDD:398773 56/140 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843299
Domainoid 1 1.000 111 1.000 Domainoid score I6249
eggNOG 1 0.900 - - E1_KOG3393
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4469
Inparanoid 1 1.050 114 1.000 Inparanoid score I4826
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54488
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003332
OrthoInspector 1 1.000 - - otm44181
orthoMCL 1 0.900 - - OOG6_102597
Panther 1 1.100 - - LDO PTHR13180
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5750
SonicParanoid 1 1.000 - - X2700
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.790

Return to query results.
Submit another query.