DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15012 and tmem50b

DIOPT Version :9

Sequence 1:NP_001163347.1 Gene:CG15012 / 38529 FlyBaseID:FBgn0035528 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001016287.1 Gene:tmem50b / 549041 XenbaseID:XB-GENE-970258 Length:158 Species:Xenopus tropicalis


Alignment Length:147 Identity:58/147 - (39%)
Similarity:92/147 - (62%) Gaps:14/147 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DASRNRNT--SIIAGLLFFAGWWVLIDAMSIDGKHQITTGHVF--IGIFGTISFCMVNA-----V 69
            |....|||  |::||:|||:|||::||| ::....|....|.|  .|:|.|::|.|:||     |
 Frog    17 DWGEKRNTIASVVAGVLFFSGWWIMIDA-AVCYPDQKQLNHAFHTCGVFSTVAFFMINAVSNAQV 80

  Fly    70 KGEHISDENSSESGARIAKIWLLVGFLMGFASIIAAIWVMIDDFINNEKKDGWFGVALLMQNVFI 134
            :|:..||.....:|||   |||.:||::.|.|:||::|::...:: .:..:.:.|:|:..||..|
 Frog    81 RGDSYSDGCMGRTGAR---IWLFIGFMLMFGSLIASMWILFGAYV-TQGLNVYPGLAVFFQNALI 141

  Fly   135 LFASLVYKFGRNEEEWN 151
            .|::|:|||||.||.|:
 Frog   142 FFSTLIYKFGRTEELWS 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15012NP_001163347.1 UPF0220 9..150 CDD:283030 57/144 (40%)
tmem50bNP_001016287.1 UPF0220 9..157 CDD:398773 57/144 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 108 1.000 Domainoid score I6345
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4707
OMA 1 1.010 - - QHG54488
OrthoDB 1 1.010 - - D1422977at2759
OrthoFinder 1 1.000 - - FOG0003332
OrthoInspector 1 1.000 - - otm49353
Panther 1 1.100 - - O PTHR13180
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5750
SonicParanoid 1 1.000 - - X2700
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.110

Return to query results.
Submit another query.