DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15012 and tmem50a

DIOPT Version :9

Sequence 1:NP_001163347.1 Gene:CG15012 / 38529 FlyBaseID:FBgn0035528 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_998694.1 Gene:tmem50a / 406850 ZFINID:ZDB-GENE-040426-2937 Length:164 Species:Danio rerio


Alignment Length:164 Identity:66/164 - (40%)
Similarity:92/164 - (56%) Gaps:18/164 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GVLDNIALHFTGDASRN------RNT--SIIAGLLFFAGWWVLIDAMSIDGK-HQITTGHVFIGI 57
            |.||.|.   .||...|      |||  ||.||:|||.|||::|||..:..| .|....:...|:
Zfish     3 GFLDGIR---CGDCECNVDWGEKRNTIASIAAGVLFFTGWWIIIDAAIMYPKEEQFHHAYHTCGV 64

  Fly    58 FGTISFCMVNAVKGEHISDENSSES--GARIAKIWLLVGFLMGFASIIAAIWVMIDDFI--NNEK 118
            ..||:|.|:|||....:..::.||.  |...|:|||.:||::.|.|:||::|::...|:  ..|.
Zfish    65 IATIAFLMINAVSNGQVRGDSYSEGCLGQTGARIWLFIGFMLAFGSLIASMWILFGGFVVTGTEH 129

  Fly   119 KD--GWFGVALLMQNVFILFASLVYKFGRNEEEW 150
            ||  .:.|:|:..||.||.|..||:||||.|:.|
Zfish   130 KDLSVYPGIAVFFQNAFIFFGGLVFKFGRTEDLW 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15012NP_001163347.1 UPF0220 9..150 CDD:283030 61/155 (39%)
tmem50aNP_998694.1 UPF0220 8..163 CDD:283030 62/157 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588393
Domainoid 1 1.000 108 1.000 Domainoid score I6391
eggNOG 1 0.900 - - E1_KOG3393
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4469
Inparanoid 1 1.050 111 1.000 Inparanoid score I4854
OMA 1 1.010 - - QHG54488
OrthoDB 1 1.010 - - D1422977at2759
OrthoFinder 1 1.000 - - FOG0003332
OrthoInspector 1 1.000 - - oto40244
orthoMCL 1 0.900 - - OOG6_102597
Panther 1 1.100 - - LDO PTHR13180
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5750
SonicParanoid 1 1.000 - - X2700
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1716.800

Return to query results.
Submit another query.