DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15012 and SPBC8D2.02c

DIOPT Version :9

Sequence 1:NP_001163347.1 Gene:CG15012 / 38529 FlyBaseID:FBgn0035528 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001342713.1 Gene:SPBC8D2.02c / 2541244 PomBaseID:SPBC8D2.02c Length:170 Species:Schizosaccharomyces pombe


Alignment Length:168 Identity:38/168 - (22%)
Similarity:75/168 - (44%) Gaps:20/168 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGVLDNIALHFTGDASRNRNTSI---IAGLLFFAGWWVLIDAMSIDGKHQITTGHV-FI------ 55
            |.:||:....|...:....:.|:   .||::|.:..||.:||............|: ||      
pombe     1 MTLLDSSIFRFRLSSLHVSSRSLGVYFAGIMFASAVWVFVDAALYSAFDYARNLHITFIDWIPFL 65

  Fly    56 -GIFGTISFCMVNAVKGEHISDEN---SSESGARIAKIWLLVGFLMGFASIIAAIWVMIDDFI-- 114
             .|.|.:   :||::....:|.::   :.||.||.|:..|.:||.:....:..:..|.|..::  
pombe    66 CSILGIV---IVNSIDKSRLSGDSFAYTDESLARKARFILFIGFALLAGGLGGSFTVFILKYVVA 127

  Fly   115 NNEKKDGWFGVALLMQNV-FILFASLVYKFGRNEEEWN 151
            ..|.|....|.|.::.|: |::.|:.::..|...::::
pombe   128 GYEGKSLLMGSANIISNILFMISATALWITGNMNDDYH 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15012NP_001163347.1 UPF0220 9..150 CDD:283030 35/157 (22%)
SPBC8D2.02cNP_001342713.1 UPF0220 8..164 CDD:310107 35/158 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3393
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102597
Panther 1 1.100 - - LDO PTHR13180
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.