DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15012 and TMEM50A

DIOPT Version :9

Sequence 1:NP_001163347.1 Gene:CG15012 / 38529 FlyBaseID:FBgn0035528 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_055128.1 Gene:TMEM50A / 23585 HGNCID:30590 Length:157 Species:Homo sapiens


Alignment Length:158 Identity:63/158 - (39%)
Similarity:89/158 - (56%) Gaps:13/158 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GVLDNIALHFTGDASRNRNT--SIIAGLLFFAGWWVLIDAMSI-----DGKHQITTGHVFIGIFG 59
            |.|:.:......|....|||  ||.||:|||.|||::|||..|     |..|..   |. .|:..
Human     3 GFLEGLRCSECIDWGEKRNTIASIAAGVLFFTGWWIIIDAAVIYPTMKDFNHSY---HA-CGVIA 63

  Fly    60 TISFCMVNAVKGEHISDENSSES--GARIAKIWLLVGFLMGFASIIAAIWVMIDDFINNEKKDGW 122
            ||:|.|:|||....:..::.||.  |...|:|||.|||::.|.|:||::|::...::..||...:
Human    64 TIAFLMINAVSNGQVRGDSYSEGCLGQTGARIWLFVGFMLAFGSLIASMWILFGGYVAKEKDIVY 128

  Fly   123 FGVALLMQNVFILFASLVYKFGRNEEEW 150
            .|:|:..||.||.|..||:||||.|:.|
Human   129 PGIAVFFQNAFIFFGGLVFKFGRTEDLW 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15012NP_001163347.1 UPF0220 9..150 CDD:283030 60/149 (40%)
TMEM50ANP_055128.1 UPF0220 9..156 CDD:283030 60/150 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153197
Domainoid 1 1.000 111 1.000 Domainoid score I6246
eggNOG 1 0.900 - - E1_KOG3393
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4469
Inparanoid 1 1.050 114 1.000 Inparanoid score I4839
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54488
OrthoDB 1 1.010 - - D1422977at2759
OrthoFinder 1 1.000 - - FOG0003332
OrthoInspector 1 1.000 - - otm42125
orthoMCL 1 0.900 - - OOG6_102597
Panther 1 1.100 - - LDO PTHR13180
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5750
SonicParanoid 1 1.000 - - X2700
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.