DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15012 and Y74C10AL.2

DIOPT Version :9

Sequence 1:NP_001163347.1 Gene:CG15012 / 38529 FlyBaseID:FBgn0035528 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_490985.1 Gene:Y74C10AL.2 / 171806 WormBaseID:WBGene00022280 Length:157 Species:Caenorhabditis elegans


Alignment Length:154 Identity:53/154 - (34%)
Similarity:85/154 - (55%) Gaps:5/154 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GVLDNIALHFTGDASRNRN--TSIIAGLLFFAGWWVLIDAMSIDGKHQITTGHVFIGIFGTISFC 64
            |..|.|..:.:.|....||  .|:::..|||.|||::||..::..|...|..:..|.:..|::..
 Worm     3 GCFDQIRCNCSFDLEGRRNAVASVVSAALFFIGWWLMIDTAAVTNKENWTNVYFIITVASTVAMF 67

  Fly    65 MVNAVKGEHISDENSSES--GARIAKIWLLVGFLMGFASIIAAIWVMIDDFINNEKKDG-WFGVA 126
            ||||:....:..|:..|.  |.:.:::||:..|::.|||::||.|::..|::..:.... |.|||
 Worm    68 MVNAISNSQVRGESLHEGLLGTKGSRLWLMAAFVVSFASLVAATWILFSDYVLIQGSHSVWPGVA 132

  Fly   127 LLMQNVFILFASLVYKFGRNEEEW 150
            |.:.|..|..:|.||||||.||.|
 Worm   133 LFLTNFIIFASSCVYKFGRTEEMW 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15012NP_001163347.1 UPF0220 9..150 CDD:283030 49/145 (34%)
Y74C10AL.2NP_490985.1 UPF0220 5..156 CDD:283030 51/150 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166557
Domainoid 1 1.000 104 1.000 Domainoid score I4207
eggNOG 1 0.900 - - E1_KOG3393
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 109 1.000 Inparanoid score I3467
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54488
OrthoDB 1 1.010 - - D1422977at2759
OrthoFinder 1 1.000 - - FOG0003332
OrthoInspector 1 1.000 - - oto19868
orthoMCL 1 0.900 - - OOG6_102597
Panther 1 1.100 - - LDO PTHR13180
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5750
SonicParanoid 1 1.000 - - X2700
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.