DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIEbeta and AT4G21010

DIOPT Version :9

Sequence 1:NP_523923.1 Gene:TfIIEbeta / 38527 FlyBaseID:FBgn0015829 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_193833.1 Gene:AT4G21010 / 827848 AraportID:AT4G21010 Length:275 Species:Arabidopsis thaliana


Alignment Length:196 Identity:49/196 - (25%)
Similarity:92/196 - (46%) Gaps:24/196 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 EILDETNQLDIGQSVKNWLASEALHNNPKVEASPCGTKFSFKPVYKIKDGKTLMRLLKQHDLKGL 158
            |.::|...:|:.   .|....::|..||||...  |.:||:|..:.|||.|.|:..:.:.|..  
plant    91 EQINEACYVDMH---NNKAVFDSLRKNPKVHYD--GRRFSYKATHNIKDKKQLLSFVNKSDKV-- 148

  Fly   159 GGILLDDVQESLPHCEKVLKN--RSAEILFVVRPIDKKKILFYNDRTANFSVDDEFQKLWRSATV 221
              |.:.|::::.|:..:.||:  .|.||.:::...|.|:...|.:......:|||.:.|:|.  :
plant   149 --IDVSDLKDAYPNVMEDLKSLKSSGEIFWLLSNTDSKEGTVYRNNMEYPKIDDELKALFRD--I 209

  Fly   222 DAMDDAKIDEYLEKQGIR----------SMQDHGLKKAIPKRKKAANKKRQFKKPRDNEHLADVL 276
            ...|..::::.|.|.|::          :.|.||:... ||.||...|:...:....|.|:.::.
plant   210 IPSDMLEVEKELLKIGLKPATNIAERRAAEQLHGVSNK-PKDKKKKKKEITNRTKLTNSHMLELF 273

  Fly   277 E 277
            :
plant   274 Q 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfIIEbetaNP_523923.1 TFIIE_beta_winged_helix 61..141 CDD:153423 13/46 (28%)
AT4G21010NP_193833.1 TFIIE_beta_winged_helix <72..275 CDD:413214 49/196 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5174
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I2580
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1160863at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103945
Panther 1 1.100 - - O PTHR12716
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.