DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIEbeta and AT4G20330

DIOPT Version :9

Sequence 1:NP_523923.1 Gene:TfIIEbeta / 38527 FlyBaseID:FBgn0015829 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_193766.1 Gene:AT4G20330 / 827781 AraportID:AT4G20330 Length:286 Species:Arabidopsis thaliana


Alignment Length:285 Identity:70/285 - (24%)
Similarity:125/285 - (43%) Gaps:49/285 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 REREAFKKRAMATPTVEKKSKPDRPAPPPPSDDSRRKMRPPNAPRLDATTYKTMSGSSQYRFGVL 71
            |||.:..::.:..|....:.||| .||...|.|:.|.....|       ..|...|:.      :
plant    28 RERTSSSRQNVPLPAAITQKKPD-AAPVKFSSDTERLQNINN-------IRKAPVGAQ------I 78

  Fly    72 AKIVKFMRTRHQDGDDHPLTIDEILDETNQLDIGQSVKNWLASEALHNNPKVEASPCGTKFSFKP 136
            .:::..:..|..     .||.::| :|...:|:.   .|....::|..|||....  |.:||:|.
plant    79 KRVIDLLYERRL-----ALTPEQI-NEWCHVDMH---ANKAVFDSLRKNPKAHYD--GRRFSYKA 132

  Fly   137 VYKIKDGKTLMRLLKQHDLKGLGGILLDDVQESLPHCEKVLKNRSAEILFVVRPIDKKKILFYND 201
            .:.:.|...|:.|::::    |.||.:.|::::.|:..:.||..||.....:....::.|.:.||
plant   133 THDVNDKNQLLSLVRKY----LDGIAVVDLKDAYPNVMEDLKALSASGDIYLLSNSQEDIAYPND 193

  Fly   202 RTANFSVDDEFQKLWRSATV--DAMDDAKIDEYLEKQGIR----------SMQDHGLKKAIPKRK 254
            ......|||||:.|:|...:  |.:|   :::.|.|.|::          :.|.||:... ||.|
plant   194 FKCEIKVDDEFKALFRDINIPNDMLD---VEKELLKIGLKPATNTAERRAAAQTHGISNK-PKDK 254

  Fly   255 KAANKKRQFKK--PRDNEHLADVLE 277
            |  .||::..|  ...|.||.::.:
plant   255 K--KKKQEISKRTKLTNAHLPELFQ 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfIIEbetaNP_523923.1 TFIIE_beta_winged_helix 61..141 CDD:153423 16/79 (20%)
AT4G20330NP_193766.1 TFIIE_beta_winged_helix <57..272 CDD:413214 59/248 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5174
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I2580
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1160863at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103945
Panther 1 1.100 - - LDO PTHR12716
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.