Sequence 1: | NP_647887.1 | Gene: | CG1316 / 38526 | FlyBaseID: | FBgn0035526 | Length: | 470 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_565132.2 | Gene: | AT1G76460 / 843979 | AraportID: | AT1G76460 | Length: | 285 | Species: | Arabidopsis thaliana |
Alignment Length: | 252 | Identity: | 48/252 - (19%) |
---|---|---|---|
Similarity: | 81/252 - (32%) | Gaps: | 89/252 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 136 EDIREEFSQWGDVESVTIVKEKNNGNPKGFGYVRFTKFYYAAVAFENCSAKYKAVFAEPKGSTRT 200
Fly 201 QRD---------------QYGRPSEDNP---LYSSSGRGN------SNFNGGGSSSGGG------ 235
Fly 236 -------------GSNSYNNDWNVSQNNDMAA------FLRMQNVPVAQPSCLEVNVSNCVNQD- 280
Fly 281 -QLWRLFDIIP-GLDYCQIMREHGPRTNEALVVYDNPEAAIYAKDKLHGLE--YPMG 333 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG1316 | NP_647887.1 | RRM1_RBM45 | 25..105 | CDD:240812 | |
RRM2_RBM45 | 122..195 | CDD:240813 | 13/58 (22%) | ||
RRM3_RBM45 | 267..339 | CDD:240814 | 14/72 (19%) | ||
RRM4_RBM45 | 383..449 | CDD:240815 | |||
AT1G76460 | NP_565132.2 | RRM_RBM24_RBM38_like | 24..99 | CDD:409818 | 16/81 (20%) |
PABP-1234 | <37..245 | CDD:130689 | 44/241 (18%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |