DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1316 and CSTF64

DIOPT Version :9

Sequence 1:NP_647887.1 Gene:CG1316 / 38526 FlyBaseID:FBgn0035526 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_177325.2 Gene:CSTF64 / 843510 AraportID:AT1G71800 Length:461 Species:Arabidopsis thaliana


Alignment Length:87 Identity:28/87 - (32%)
Similarity:42/87 - (48%) Gaps:7/87 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 IPKTATEEDIREEFSQWGDVESVTIVKEKNNGNPKGFGYVRFTKFYYAAVAFENCSA------KY 187
            ||..||||.:||...:.|.|.|..:|.::..|.|||:|:..:.....|..|..|..:      :.
plant    16 IPYDATEEQLREICGEVGPVVSFRLVTDRETGKPKGYGFCEYKDEETALSARRNLQSYEINGRQL 80

  Fly   188 KAVFAE-PKGSTRTQRDQYGRP 208
            :..||| .||:.:|:....|.|
plant    81 RVDFAENDKGTDKTRDQSQGGP 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1316NP_647887.1 RRM1_RBM45 25..105 CDD:240812
RRM2_RBM45 122..195 CDD:240813 23/72 (32%)
RRM3_RBM45 267..339 CDD:240814
RRM4_RBM45 383..449 CDD:240815
CSTF64NP_177325.2 PABP-1234 <11..318 CDD:130689 28/87 (32%)
RRM_CSTF2_CSTF2T 11..85 CDD:241115 20/68 (29%)
CSTF2_hinge 160..228 CDD:373015
PAT1 <222..>433 CDD:370676
CSTF_C 419..454 CDD:373006
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.